Mouse anti-Human NUPL1 Monoclonal Antibody | anti-NUPL1 antibody

NUPL1 (Nucleoporin p58/p45, Nucleoporin-like Protein 1, KIAA0410) (HRP)

Cat. Num. AAA6153901

• Gene Names: NUP58; NUP45; NUPL1; PRO2463
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NUPL1; Monoclonal Antibody; NUPL1 (Nucleoporin p58/p45; Nucleoporin-like Protein 1; KIAA0410) (HRP); anti-NUPL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G11
• Specificity: Recognizes human NUPL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 4236

• Applicable Applications for anti-NUPL1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa323-422 from NUPL1 (NP_054808) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged NUPL1 is approximately 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to NUPL1 on HeLa cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NUPL1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Product Categories/Family for anti-NUPL1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519312193
• NCBI GeneID: 9818
• NCBI Accession #: NM_014089.4
• NCBI GenBank Nucleotide #: NM_014089
• UniProt Accession #: Q9BVL2
• NCBI Official Full Name: Homo sapiens nucleoporin 58 (NUP58), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: nucleoporin 58
• NCBI Official Symbol: NUP58
• NCBI Official Synonym Symbols: NUP45; NUPL1; PRO2463
• NCBI Protein Information: nucleoporin p58/p45
• UniProt Protein Name: Nucleoporin p58/p45
• UniProt Gene Name: NUPL1
• UniProt Synonym Gene Names: KIAA0410
• UniProt Entry Name: NUPL1_HUMAN

NCBI Description

This gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]