Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NUPL1 Monoclonal Antibody | anti-NUPL1 antibody

NUPL1 (Nucleoporin p58/p45, Nucleoporin-like Protein 1, KIAA0410) (PE)

Gene Names
NUP58; NUP45; NUPL1; PRO2463
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUPL1; Monoclonal Antibody; NUPL1 (Nucleoporin p58/p45; Nucleoporin-like Protein 1; KIAA0410) (PE); anti-NUPL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G11
Specificity
Recognizes human NUPL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
4236
Applicable Applications for anti-NUPL1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa323-422 from NUPL1 (NP_054808) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged NUPL1 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NUPL1 is approximately 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to NUPL1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to NUPL1 on HeLa cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NUPL1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NUPL1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])
Product Categories/Family for anti-NUPL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens nucleoporin 58 (NUP58), transcript variant 1, mRNA
NCBI Official Synonym Full Names
nucleoporin 58
NCBI Official Symbol
NUP58
NCBI Official Synonym Symbols
NUP45; NUPL1; PRO2463
NCBI Protein Information
nucleoporin p58/p45
UniProt Protein Name
Nucleoporin p58/p45
UniProt Gene Name
NUPL1
UniProt Synonym Gene Names
KIAA0410
UniProt Entry Name
NUPL1_HUMAN

NCBI Description

This gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Research Articles on NUPL1

Similar Products

Product Notes

The NUPL1 nupl1 (Catalog #AAA6159204) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NUPL1 (Nucleoporin p58/p45, Nucleoporin-like Protein 1, KIAA0410) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUPL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUPL1 nupl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUPL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.