Mouse anti-Human NUP133 Monoclonal Antibody | anti-NUP133 antibody

NUP133 (Nuclear Pore Complex Protein Nup133, Nucleoporin Nup133, Nucleoporin 133kDa, 133kD Nucleoporin, hNUP133, FLJ10814, MGC21133)

Cat. Num. AAA6002708

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NUP133; Monoclonal Antibody; NUP133 (Nuclear Pore Complex Protein Nup133; Nucleoporin Nup133; Nucleoporin 133kDa; 133kD Nucleoporin; hNUP133; FLJ10814; MGC21133); Anti -NUP133 (Nuclear Pore Complex Protein Nup133; anti-NUP133 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 3E8
• Specificity: Recognizes human NUP133.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ

• Applicable Applications for anti-NUP133 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Immunohistochemistry and Western Blot.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa1069-1156 from human NUP133 (NP_060700) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.68kD).)

Western Blot (WB)

(NUP133 monoclonal antibody Western Blot analysis of NUP133 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NUP133 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NUP133 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-NUP133 antibody

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.

Product Categories/Family for anti-NUP133 antibody

Antibodies; Abs to Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 486563
• UniProt Accession #: P36161; D6VXE2
• Molecular Weight: 133,321 Da
• NCBI Official Full Name: NUP133
• UniProt Protein Name: Nucleoporin NUP133
• Protein Family: Nucleoporin
• UniProt Gene Name: NUP133
• UniProt Synonym Gene Names: RAT3
• UniProt Entry Name: NU133_YEAST

Uniprot Description

Function: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. NUP133 is involved in nuclear poly(A)+ RNA, tRNA and pre-ribosome export, in GSP1 nuclear import, in NPC assembly and distribution, as well as in nuclear envelope organization. Ref.1 Ref.5 Ref.6 Ref.7 Ref.8 Ref.10 Ref.11

Subunit structure: The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active, nuclear transport receptor-mediated bidirectional transport of macromolecules such as proteins, RNAs, ribonucleoparticles (RNPs), and ribosomal subunits across the nuclear envelope. The 55-60 MDa NPC is composed of at least 31 different subunits: ASM4, CDC31, GLE1, GLE2, NDC1, NIC96, NSP1, NUP1, NUP2, NUP100, NUP116, NUP120, NUP133, NUP145, NUP157, NUP159, NUP170, NUP188, NUP192, NUP42, NUP49, NUP53, NUP57, NUP60, NUP82, NUP84, NUP85, POM152, POM34, SEH1 and SEC1. Due to its 8-fold rotational symmetry, all subunits are present with 8 copies or multiples thereof. NUP133 is part of the heptameric 0.5 MDa autoassembling NUP84 NPC subcomplex (NUP84, NUP85, NUP120, NUP133, NUP145C, SEC13 and SEH1). Ref.9

Subcellular location: Nucleus › nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side. Note: Symmetric distribution.

Domain: Usually mRNA binding pumilio repeats come in 8 copies. In the 8-fold symmetry of the NPC the 8 repeats may be provided by eight copies of NUP133.

Miscellaneous: Present with 3060 molecules/cell in log phase SD medium.

Sequence similarities: Belongs to the nucleoporin Nup133 family.