Mouse anti-Human NUP133 Monoclonal Antibody | anti-NUP133 antibody

NUP133 (Nuclear Pore Complex Protein Nup133, Nucleoporin Nup133, Nucleoporin 133kDa, 133kD Nucleoporin, hNUP133, FLJ10814, MGC21133) (FITC)

Cat. Num. AAA6148593

• Gene Names: NUP133; GAMOS8; NPHS18; hNUP133
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NUP133; Monoclonal Antibody; NUP133 (Nuclear Pore Complex Protein Nup133; Nucleoporin Nup133; Nucleoporin 133kDa; 133kD Nucleoporin; hNUP133; FLJ10814; MGC21133) (FITC); anti-NUP133 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 3E8
• Specificity: Recognizes human NUP133.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1156

• Applicable Applications for anti-NUP133 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1069-1156 from human NUP133 (NP_060700) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.68kD).)

Western Blot (WB)

(NUP133 monoclonal antibody Western Blot analysis of NUP133 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NUP133 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NUP133 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-NUP133 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 26051235
• NCBI GeneID: 55746
• NCBI Accession #: NP_060700
• NCBI GenBank Nucleotide #: NM_018230
• UniProt Accession #: Q8WUM0
• NCBI Official Full Name: nuclear pore complex protein Nup133
• NCBI Official Synonym Full Names: nucleoporin 133
• NCBI Official Symbol: NUP133
• NCBI Official Synonym Symbols: GAMOS8; NPHS18; hNUP133
• NCBI Protein Information: nuclear pore complex protein Nup133
• UniProt Protein Name: Nuclear pore complex protein Nup133
• Protein Family: Nucleoporin
• UniProt Gene Name: NUP133
• UniProt Entry Name: NU133_HUMAN

NCBI Description

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells. [provided by RefSeq, Jul 2008]