Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HS3ST1 expression in transfected 293T cell line by HS3ST1 polyclonal antibody. Lane 1: HS3ST1 transfected lysate (35.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HS3ST1 Polyclonal Antibody | anti-HS3ST1 antibody

HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1)

Gene Names
HS3ST1; 3OST; 3OST1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HS3ST1; Polyclonal Antibody; HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1; Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1; 3-OST-1; Heparan Sulfate 3-O-sulfotransferase 1; h3-OST-1; 3OST; 3OST1); Anti -HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1; anti-HS3ST1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HS3ST1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Applicable Applications for anti-HS3ST1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HS3ST1, aa1-307 (NP_005105.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HS3ST1 expression in transfected 293T cell line by HS3ST1 polyclonal antibody. Lane 1: HS3ST1 transfected lysate (35.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HS3ST1 expression in transfected 293T cell line by HS3ST1 polyclonal antibody. Lane 1: HS3ST1 transfected lysate (35.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HS3ST1 antibody
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.
Product Categories/Family for anti-HS3ST1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,773 Da
NCBI Official Full Name
HS3ST1 protein
NCBI Official Synonym Full Names
heparan sulfate (glucosamine) 3-O-sulfotransferase 1
NCBI Official Symbol
HS3ST1
NCBI Official Synonym Symbols
3OST; 3OST1
NCBI Protein Information
heparan sulfate glucosamine 3-O-sulfotransferase 1; 3-OST-1; h3-OST-1; heparan sulfate 3-O-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1
UniProt Protein Name
Heparan sulfate glucosamine 3-O-sulfotransferase 1
UniProt Gene Name
HS3ST1
UniProt Synonym Gene Names
3OST; 3OST1; 3-OST-1; Heparan sulfate 3-O-sulfotransferase 1; h3-OST-1
UniProt Entry Name
HS3S1_HUMAN

NCBI Description

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq, Jul 2008]

Uniprot Description

HS3ST1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site. Belongs to the sulfotransferase 1 family.

Protein type: EC 2.8.2.23; Transferase; Glycan Metabolism - heparan sulfate biosynthesis

Chromosomal Location of Human Ortholog: 4p16

Cellular Component: Golgi lumen; integral to membrane

Molecular Function: sulfotransferase activity; heparin-glucosamine 3-O-sulfotransferase activity

Biological Process: glycosaminoglycan biosynthetic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; pathogenesis

Research Articles on HS3ST1

Similar Products

Product Notes

The HS3ST1 hs3st1 (Catalog #AAA6009125) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HS3ST1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HS3ST1 hs3st1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAALLLGAVL LVAQPQLVPS RPAELGQQEL LRKAGTLQDD VRDGVAPNGS AQQLPQTIII GVRKGGTRAL LEMLSLHPDV AAAENEVHFF DWEEHYSHGL GWYLSQMPFS WPHQLTVEKT PAYFTSPKVP ERVYSMNPSI RLLLILRDPS ERVLSDYTQV FYNHMQKHKP YPSIEEFLVR DGRLNVDYKA LNRSLYHVHM QNWLRFFPLR HIHIVDGDRL IRDPFPEIQK VERFLKLSPQ INASNFYFNK TKGFYCLRDS GRDRCLHESK GRAHPQVDPK LLNKLHEYFH EPNKKFFELV GRTFDWH. It is sometimes possible for the material contained within the vial of "HS3ST1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.