Mouse anti-Human NUDT4 Monoclonal Antibody | anti-NUDT4 antibody

NUDT4 (Diphosphoinositol Polyphosphate Phosphohydrolase 2, DIPP-2, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 2, Nucleoside Diphosphate-linked Moiety X Motif 4, Nudix Motif 4, DIPP2, KIAA0487, HDCMB47P)

Cat. Num. AAA6006359

• Gene Names: NUDT4; atnudt4; F15H18.18; nudix hydrolase homolog 4; NUDT4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NUDT4; Monoclonal Antibody; NUDT4 (Diphosphoinositol Polyphosphate Phosphohydrolase 2; DIPP-2; Diadenosine 5'; 5'''-P1; P6-hexaphosphate Hydrolase 2; Nucleoside Diphosphate-linked Moiety X Motif 4; Nudix Motif 4; DIPP2; KIAA0487; HDCMB47P); Anti -NUDT4 (Diphosphoinositol Polyphosphate Phosphohydrolase 2; anti-NUDT4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F2
• Specificity: Recognizes human NUDT4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR*

• Applicable Applications for anti-NUDT4 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-182 from NUDT4 (AAH12069) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.02kD).)

Testing Data

(Detection limit for recombinant GST tagged NUDT4 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-NUDT4 antibody

NUDT4 (Nudix (nucleoside diphosphate linked moiety X)-type motif 4) is a member of the DIPP subfamily of Nudix proteins which hydrolyze specific diphosphoinositol polyphosphates and diadenosine polyphosphates. NUDT4 cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. It is also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A.

Product Categories/Family for anti-NUDT4 antibody

Antibodies; Abs to Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 15221055
• NCBI GeneID: 838410
• NCBI Accession #: NP_173266.1
• NCBI GenBank Nucleotide #: NM_101688.2
• UniProt Accession #: Q9LE73; Q0WU23
• Molecular Weight: 23,701 Da
• NCBI Official Full Name: nudix hydrolase 4
• NCBI Official Symbol: NUDT4
• NCBI Official Synonym Symbols: atnudt4; F15H18.18; nudix hydrolase homolog 4; NUDT4
• NCBI Protein Information: nudix hydrolase 4
• UniProt Protein Name: Nudix hydrolase 4
• Protein Family: Nudix hydrolase
• UniProt Gene Name: NUDT4
• UniProt Synonym Gene Names: NUDX4; AtNUDT4
• UniProt Entry Name: NUDT4_ARATH

Uniprot Description

Function: Probably mediates the hydrolysis of some nucleoside diphosphate derivatives. In vitro, it can use both NADH and ADP-ribose as substrates; however the relevance of such substrates in vivo is unclear. Ref.5

Catalytic activity: ADP-D-ribose + H2O = AMP + D-ribose 5-phosphate.NAD+ + H2O = AMP + NMN.

Cofactor: Magnesium or manganese

By similarity.

Tissue specificity: Expressed in roots, stems and leaves. Ref.5

Sequence similarities: Belongs to the Nudix hydrolase family.Contains 1 nudix hydrolase domain.