Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NUDT10 expression in transfected 293T cell line by NUDT10 polyclonal antibody. Lane 1: NUDT10 transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NUDT10 Polyclonal Antibody | anti-NUDT9 antibody

NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha, DIPP3-alpha, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 3-alpha, Nucleoside Diphosphate-Linked Moiety X Motif 10, Nudix Motif 10, hAps2, APS2, DIPP3A)

Gene Names
NUDT9; NUDT10
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NUDT10; Polyclonal Antibody; NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha; DIPP3-alpha; Diadenosine 5'; 5'''-P1; P6-hexaphosphate Hydrolase 3-alpha; Nucleoside Diphosphate-Linked Moiety X Motif 10; Nudix Motif 10; hAps2; APS2; DIPP3A); Anti -NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha; anti-NUDT9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NUDT10.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Applicable Applications for anti-NUDT9 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NUDT10, aa1-164 (NP_694853.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NUDT10 expression in transfected 293T cell line by NUDT10 polyclonal antibody. Lane 1: NUDT10 transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NUDT10 expression in transfected 293T cell line by NUDT10 polyclonal antibody. Lane 1: NUDT10 transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NUDT9 antibody
Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
Product Categories/Family for anti-NUDT9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,125 Da
NCBI Official Full Name
NUDT10
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 9
NCBI Official Symbol
NUDT9
NCBI Official Synonym Symbols
NUDT10
NCBI Protein Information
ADP-ribose pyrophosphatase, mitochondrial; ADPR-PPase; ADP-ribose diphosphatase; ADP-ribose phosphohydrolase; ADP-ribose pyrosphosphatase NUDT9; adenosine diphosphoribose pyrophosphatase; nucleoside diphosphate linked moiety X-type motif 9
UniProt Protein Name
ADP-ribose pyrophosphatase, mitochondrial
Protein Family
UniProt Gene Name
NUDT9
UniProt Synonym Gene Names
NUDT10; ADPR-PPase
UniProt Entry Name
NUDT9_HUMAN

NCBI Description

The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NUDT9: Hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'- phosphate. Belongs to the Nudix hydrolase family. NudF subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; EC 3.6.1.13; Hydrolase; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: mitochondrial matrix; intracellular

Molecular Function: ADP-ribose diphosphatase activity; ADP-sugar diphosphatase activity; adenosine-diphosphatase activity

Biological Process: nucleobase, nucleoside and nucleotide metabolic process; ADP catabolic process; IDP catabolic process

Research Articles on NUDT9

Similar Products

Product Notes

The NUDT9 nudt9 (Catalog #AAA641677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha, DIPP3-alpha, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 3-alpha, Nucleoside Diphosphate-Linked Moiety X Motif 10, Nudix Motif 10, hAps2, APS2, DIPP3A) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NUDT9 nudt9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKCKPNQTRT YDPEGFKKRA ACLCFRSERE DEVLLVSSSR YPDRWIVPGG GMEPEEEPGG AAVREVYEEA GVKGKLGRLL GVFEQNQDPK HRTYVYVLTV TELLEDWEDS VSIGRKREWF KVEDAIKVLQ CHKPVHAEYL EKLKLGGSPT NGNSMAPSSP DSDP. It is sometimes possible for the material contained within the vial of "NUDT10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.