Mouse anti-Human NUDT4 Monoclonal Antibody | anti-NUDT4 antibody

NUDT4 (Diphosphoinositol Polyphosphate Phosphohydrolase 2, DIPP-2, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 2, Nucleoside Diphosphate-linked Moiety X Motif 4, Nudix Motif 4, DIPP2, KIAA0487, HDCMB47P) (PE)

Cat. Num. AAA6159195

• Gene Names: NUDT4; DIPP2; HDCMB47P; DIPP2beta; DIPP2alpha
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NUDT4; Monoclonal Antibody; NUDT4 (Diphosphoinositol Polyphosphate Phosphohydrolase 2; DIPP-2; Diadenosine 5'; 5'''-P1; P6-hexaphosphate Hydrolase 2; Nucleoside Diphosphate-linked Moiety X Motif 4; Nudix Motif 4; DIPP2; KIAA0487; HDCMB47P) (PE); anti-NUDT4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F2
• Specificity: Recognizes human NUDT4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NUDT4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-182 from NUDT4 (AAH12069) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.02kD).)

Testing Data

(Detection limit for recombinant GST tagged NUDT4 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-NUDT4 antibody

NUDT4 (Nudix (nucleoside diphosphate linked moiety X)-type motif 4) is a member of the DIPP subfamily of Nudix proteins which hydrolyze specific diphosphoinositol polyphosphates and diadenosine polyphosphates. NUDT4 cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. It is also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A.

Product Categories/Family for anti-NUDT4 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 15082324
• NCBI GeneID: 11163
• Molecular Weight: 14,395 Da
• NCBI Official Full Name: Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 4, mRNA
• NCBI Official Synonym Full Names: nudix hydrolase 4
• NCBI Official Symbol: NUDT4
• NCBI Official Synonym Symbols: DIPP2; HDCMB47P; DIPP2beta; DIPP2alpha
• NCBI Protein Information: diphosphoinositol polyphosphate phosphohydrolase 2
• Protein Family: Nudix hydrolase

NCBI Description

The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008]