Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NUDT10 expression in transfected 293T cell line by NUDT10 polyclonal antibody. Lane 1: NUDT10 transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NUDT10 Polyclonal Antibody | anti-NUDT10 antibody

NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha, DIPP3-alpha, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 3-alpha, Nucleoside Diphosphate-Linked Moiety X Motif 10, Nudix Motif 10, hAps2, APS2, DIPP3A) (AP)

Gene Names
NUDT10; APS2; DIPP3a; DIPP3-alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUDT10; Polyclonal Antibody; NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha; DIPP3-alpha; Diadenosine 5'; 5'''-P1; P6-hexaphosphate Hydrolase 3-alpha; Nucleoside Diphosphate-Linked Moiety X Motif 10; Nudix Motif 10; hAps2; APS2; DIPP3A) (AP); anti-NUDT10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NUDT10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NUDT10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NUDT10, aa1-164 (NP_694853.1).
Immunogen Sequence
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NUDT10 expression in transfected 293T cell line by NUDT10 polyclonal antibody. Lane 1: NUDT10 transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NUDT10 expression in transfected 293T cell line by NUDT10 polyclonal antibody. Lane 1: NUDT10 transfected lysate (18.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NUDT10 antibody
Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
Product Categories/Family for anti-NUDT10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,500 Da
NCBI Official Full Name
diphosphoinositol polyphosphate phosphohydrolase 3-alpha
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 10
NCBI Official Symbol
NUDT10
NCBI Official Synonym Symbols
APS2; DIPP3a; DIPP3-alpha
NCBI Protein Information
diphosphoinositol polyphosphate phosphohydrolase 3-alpha; diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-alpha; diadenosine hexaphosphate hydrolase (AMP-forming); nucleoside diphosphate-linked moiety X motif 10; nudix motif 10
UniProt Protein Name
Diphosphoinositol polyphosphate phosphohydrolase 3-alpha
Protein Family
UniProt Gene Name
NUDT10
UniProt Synonym Gene Names
APS2; DIPP3A; DIPP-3-alpha; DIPP3-alpha; hDIPP3alpha; Nudix motif 10
UniProt Entry Name
NUD10_HUMAN

NCBI Description

This gene is a member of the nudix (nucleoside diphosphate linked moiety X)-type motif containing family. The encoded protein is a phosphohydrolase and may regulate the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to the regulation of intracellular trafficking. In some populations putative prostate cancer susceptibility alleles have been identified for this gene. Alternatively spliced transcript variants, which differ only in the 5' UTR, have been found for this gene. [provided by RefSeq, Feb 2015]

Uniprot Description

NUDT10: Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Belongs to the Nudix hydrolase family. DIPP subfamily.

Protein type: EC 3.6.1.52; EC 3.6.1.60; Hydrolase

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: cytosol

Molecular Function: metal ion binding; diphosphoinositol-polyphosphate diphosphatase activity

Biological Process: inositol phosphate metabolic process

Research Articles on NUDT10

Similar Products

Product Notes

The NUDT10 nudt10 (Catalog #AAA6387755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT10 (Diphosphoinositol Polyphosphate Phosphohydrolase 3-alpha, DIPP3-alpha, Diadenosine 5',5'''-P1,P6-hexaphosphate Hydrolase 3-alpha, Nucleoside Diphosphate-Linked Moiety X Motif 10, Nudix Motif 10, hAps2, APS2, DIPP3A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUDT10 nudt10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUDT10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.