Mouse anti-Human NR2C2 Monoclonal Antibody | anti-NR2C2 antibody

NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2, Orphan Nuclear Receptor TAK1, Orphan Nuclear Receptor TR4, Testicular Receptor 4, TAK1, TR4) (PE)

Cat. Num. AAA6159161

• Gene Names: NR2C2; TR4; TAK1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NR2C2; Monoclonal Antibody; NR2C2 (Nuclear Receptor Subfamily 2 Group C Member 2; Orphan Nuclear Receptor TAK1; Orphan Nuclear Receptor TR4; Testicular Receptor 4; TAK1; TR4) (PE); anti-NR2C2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A5
• Specificity: Recognizes human NR2C2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 8476

• Applicable Applications for anti-NR2C2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa43-152 from human NR2C2 (NP_003289) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody. Lane 1: NR2C2 transfected lysate (65.414kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NR2C2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western blot analysis of NR2C2 over-expressed 293 cell line, cotransfected with NR2C2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NR2C2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-NR2C2 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 1677537419
• NCBI GeneID: 7182
• NCBI Accession #: NM_003298.5
• NCBI GenBank Nucleotide #: NM_003298
• NCBI Official Full Name: Homo sapiens nuclear receptor subfamily 2 group C member 2 (NR2C2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: nuclear receptor subfamily 2 group C member 2
• NCBI Official Symbol: NR2C2
• NCBI Official Synonym Symbols: TR4; TAK1
• NCBI Protein Information: nuclear receptor subfamily 2 group C member 2
• Protein Family: Nuclear receptor subfamily

NCBI Description

This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]