Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24196'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.89 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24196' and pd.language_id = 1
Query
Database
1.63 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24196'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.61 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24196'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24196' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24196'
⇄specificity => string (63) "Recognizes human EFHD1. Species Crossreactivity: mouse and rat."
$value['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value['app_tested']
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (752) "WB (Western Blot)||EFHD1 monoclonal antibody (M05), Western Blot analysis of...
$value['testing_protocols']
WB (Western Blot)||EFHD1 monoclonal antibody (M05), Western Blot analysis of EFHD1 expression in HeLa.||AAA24196_WB6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to EFHD1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].||AAA24196_IHC5.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody (M05). Western Blot analysis of EFHD1 expression in NIH/3T3.||AAA24196_WB4.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody. Western Blot analysis of EFHD1 expression in Raw 264.7.||AAA24196_WB3.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody. Western Blot analysis of EFHD1 expression in PC-12.||AAA24196_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (33.81kD).||AAA24196_WB.jpg
⇄⧉etc_term1 => string (245) "Immunogen||Full length recombinant corresponding to aa168-238 from human EFH...
$value['etc_term1']
Immunogen||Full length recombinant corresponding to aa168-238 from human EFHD1 (NP_079478) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN!!Conjugate||AP
EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (AP)
⇄products_name_syn => string (3) "N/A"
$value['products_name_syn']
⇄products_gene_name => string (5) "EFHD1"
$value['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value['products_description']
⇄products_references => string (3) "N/A"
$value['products_references']
⇄⧉products_related_diseases => string (155) "Adenocarcinoma||2!!Kidney Diseases||2!!Nervous System Diseases||1!!Nervous S...
$value['products_related_diseases']
Adenocarcinoma||2!!Kidney Diseases||2!!Nervous System Diseases||1!!Nervous System Malformations||1!!Lung Neoplasms||1!!Inflammation||1!!Breast Neoplasms||1
EF-hand domain-containing protein D1; swiprosin-2; OTTHUMP00000164362; OTTHUMP00000203630; OTTHUMP00000203631; OTTHUMP00000203632; EF hand domain containing 1; EF hand domain family, member D1; EF-hand domain-containing protein 1
⇄specificity => string (63) "Recognizes human EFHD1. Species Crossreactivity: mouse and rat."
$value->a['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->a['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value->a['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value->a['app_tested']
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (752) "WB (Western Blot)||EFHD1 monoclonal antibody (M05), Western Blot analysis of...
$value->a['testing_protocols']
WB (Western Blot)||EFHD1 monoclonal antibody (M05), Western Blot analysis of EFHD1 expression in HeLa.||AAA24196_WB6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to EFHD1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].||AAA24196_IHC5.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody (M05). Western Blot analysis of EFHD1 expression in NIH/3T3.||AAA24196_WB4.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody. Western Blot analysis of EFHD1 expression in Raw 264.7.||AAA24196_WB3.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody. Western Blot analysis of EFHD1 expression in PC-12.||AAA24196_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (33.81kD).||AAA24196_WB.jpg
⇄⧉etc_term1 => string (245) "Immunogen||Full length recombinant corresponding to aa168-238 from human EFH...
$value->a['etc_term1']
Immunogen||Full length recombinant corresponding to aa168-238 from human EFHD1 (NP_079478) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN!!Conjugate||AP
EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (AP)
⇄products_name_syn => string (3) "N/A"
$value->a['products_name_syn']
⇄products_gene_name => string (5) "EFHD1"
$value->a['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->a['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value->a['products_description']
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄⧉products_related_diseases => string (155) "Adenocarcinoma||2!!Kidney Diseases||2!!Nervous System Diseases||1!!Nervous S...
$value->a['products_related_diseases']
Adenocarcinoma||2!!Kidney Diseases||2!!Nervous System Diseases||1!!Nervous System Malformations||1!!Lung Neoplasms||1!!Inflammation||1!!Breast Neoplasms||1
EF-hand domain-containing protein D1; swiprosin-2; OTTHUMP00000164362; OTTHUMP00000203630; OTTHUMP00000203631; OTTHUMP00000203632; EF hand domain containing 1; EF hand domain family, member D1; EF-hand domain-containing protein 1
⇄specificity => string (63) "Recognizes human EFHD1. Species Crossreactivity: mouse and rat."
$value->d['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->d['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value->d['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value->d['app_tested']
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (752) "WB (Western Blot)||EFHD1 monoclonal antibody (M05), Western Blot analysis of...
$value->d['testing_protocols']
WB (Western Blot)||EFHD1 monoclonal antibody (M05), Western Blot analysis of EFHD1 expression in HeLa.||AAA24196_WB6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to EFHD1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].||AAA24196_IHC5.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody (M05). Western Blot analysis of EFHD1 expression in NIH/3T3.||AAA24196_WB4.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody. Western Blot analysis of EFHD1 expression in Raw 264.7.||AAA24196_WB3.jpg!!WB (Western Blot)||EFHD1 monoclonal antibody. Western Blot analysis of EFHD1 expression in PC-12.||AAA24196_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (33.81kD).||AAA24196_WB.jpg
⇄⧉etc_term1 => string (245) "Immunogen||Full length recombinant corresponding to aa168-238 from human EFH...
$value->d['etc_term1']
Immunogen||Full length recombinant corresponding to aa168-238 from human EFHD1 (NP_079478) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN!!Conjugate||AP
EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (AP)
⇄products_name_syn => string (3) "N/A"
$value->d['products_name_syn']
⇄products_gene_name => string (5) "EFHD1"
$value->d['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->d['products_gene_name_syn']
⇄products_description => string (3) "N/A"
$value->d['products_description']
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄⧉products_related_diseases => string (155) "Adenocarcinoma||2!!Kidney Diseases||2!!Nervous System Diseases||1!!Nervous S...
$value->d['products_related_diseases']
Adenocarcinoma||2!!Kidney Diseases||2!!Nervous System Diseases||1!!Nervous System Malformations||1!!Lung Neoplasms||1!!Inflammation||1!!Breast Neoplasms||1
EF-hand domain-containing protein D1; swiprosin-2; OTTHUMP00000164362; OTTHUMP00000203630; OTTHUMP00000203631; OTTHUMP00000203632; EF hand domain containing 1; EF hand domain family, member D1; EF-hand domain-containing protein 1
⇄⧉etc_term1 => string (142) "Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative...
$value[0]['_source']['etc_term1']
Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||62.5-4000pg/mL!!Sensitivity||37.5pg/mL
⇄⧉etc_term2 => string (372) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[0]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, mid range and high level Human DAP6 were tested 20 times on one plate, respectively.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, mid range and high level Human DAP6 were tested on 3 different plates, 20 replicates in each plate.
⇄⧉products_description => string (1214) "Intended Uses: This ELISA kit applies to the in vitro quantitative determina...
$value[0]['_source']['products_description']
Intended Uses: This ELISA kit applies to the in vitro quantitative determination of Human DAP6 concentrations in serum, plasma and other biological fluids.<br><br>Principle of the Assay: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human DAP6. Standards or samples are added to the micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for Human DAP6 and Avidin- Horseradish Peroxidase (HRP) conjugate are added successively to each micro plate well and incubated. Free components are washed away. The substrate solution is added to each well. Only those wells that contain Human DAP6, biotinylated detection antibody and Avidin-HRP conjugate will appear blue in color. The enzyme-substrate reaction is terminated by the addition of stop solution and the color turns yellow. The optical density (OD) is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The OD value is proportional to the concentration of Human DAP6. You can calculate the concentration of Human DAP6 in the samples by comparing the OD of the samples to the standard curve.
death domain-associated protein 6; CENP-C binding protein; ETS1-associated protein 1; Fas-binding protein; death-associated protein 6; fas death domain-associated protein
⇄⧉search_terms => string (729) "aaa21729 human this kit recognizes dap6 in samples no significant cross reac...
$value[0]['_source']['search_terms']
aaa21729 human this kit recognizes dap6 in samples no significant cross reactivity or interference between and analogues was observed typical testing data standard curve for reference only aaa21729_td elisa death associated protein 6 domain isoform a daxx eap1 bing2 cenp c binding ets1 1 fas 75,563 da hdaxx daxx_human 215422388 np_001135441.1 q9uer7 nm_001141969.1 o14747 o15141 o15208 q5stk9 q9bwi3 b4e1i3 f5anj6 f5anj7 f5h082 603186 serum plasma other biological fluids assay type quantitative sandwich detection range 62.5 4000pg ml sensitivity 37.5pg intra precision within an 3 with low mid high level were tested 20 times on one plate respectively inter assays different plates replicates each protein6 ets11 an3 tested20
⇄⧉specificity => string (189) "This assay has high sensitivity and excellent specificity for detection of h...
$value[1]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human DAF/CD55. No significant cross-reactivity or interference between human DAF/CD55 and analogues was observed.
⇄purity => string (3) "N/A"
$value[1]['_source']['purity']
⇄form => string (3) "N/A"
$value[1]['_source']['form']
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[1]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[1]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[1]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[1]['_source']['products_weight']
⇄products_status => boolean true
$value[1]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[1]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[1]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[1]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[1]['_source']['language_id']
⇄products_name => string (33) "death-associated protein kinase 1"
Human death-associated protein kinase (DAPK) ELISA Kit; DAPK; DKFZp781I035; ; death-associated protein kinase 1
⇄products_gene_name => string (5) "DAPK1"
$value[1]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[1]['_source']['products_gene_name_syn']
⇄⧉products_description => string (747) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[1]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for DAF/CD55 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any DAF/CD55 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for DAF/CD55 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of DAF/CD55 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_pathways => string (233) "Apoptosis Pathway||105648!!Bladder Cancer Pathway||83115!!Bladder Cancer Pat...
$value[1]['_source']['ncbi_pathways']
Apoptosis Pathway||105648!!Bladder Cancer Pathway||83115!!Bladder Cancer Pathway||527!!IFN-gamma Pathway||138040!!Pathways In Cancer||83105!!Regulation Of Apoptosis Pathway||105685!!Role Of DCC In Regulating Apoptosis Pathway||161011
⇄sp_protein_name => string (33) "Death-associated protein kinase 1"
⇄⧉search_terms => string (579) "aaa15345 human this assay has high sensitivity and excellent specificity for...
$value[1]['_source']['search_terms']
aaa15345 human this assay has high sensitivity and excellent specificity for detection of daf cd55 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15345_td elisa kit death associated protein kinase 1 dapk dkfzp781i035 dapk1 dap 160,046 da dapk1_human 570359575 np_001275658.1 p53355 nm_001288729.1 q14cq7 q1w5w0 q68cp8 q6zrz3 q9btl8 b7zld2 b7zle7 600831 samples serum plasma cell culture supernates type quantitative sandwich range 0.625 ng ml 40 0.156 intra precision within an cv kinase1 ml40
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of h...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human TNFAIP6. No significant cross-reactivity or interference between human TNFAIP6 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[2]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[2]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[2]['_source']['products_weight']
⇄products_status => boolean true
$value[2]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[2]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[2]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[2]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[2]['_source']['language_id']
⇄products_name => string (46) "tumor necrosis factor, alpha-induced protein 6"
Human Tumor necrosis factor-inducible gene 6 protein (TNFAIP6) ELISA kit; TSG-6; TSG6; hyaluronate-binding protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; tumor necrosis factor; alpha-induced protein 6
⇄products_gene_name => string (7) "TNFAIP6"
$value[2]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[2]['_source']['products_gene_name_syn']
⇄⧉products_description => string (743) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[2]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TNFAIP6 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TNFAIP6 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TNFAIP6 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TNFAIP6 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (580) "aaa18228 human this assay has high sensitivity and excellent specificity for...
$value[2]['_source']['search_terms']
aaa18228 human this assay has high sensitivity and excellent specificity for detection of tnfaip6 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18228_td elisa kit tumor necrosis factor alpha induced protein 6 inducible gene tsg tsg6 hyaluronate binding stimulated tnf 31,203 da tsg6_human 26051243 np_009046.2 p98066 nm_007115.3 q53ti7 q8wwi9 600410 samples serum plasma cell culture supernates type quantitative sandwich range 0.156 ng ml 10 < 0.039 intra precision within an cv protein6 ml10
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of m...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse TNFAIP6. No significant cross-reactivity or interference between mouse TNFAIP6 and analogues was observed.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[3]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[3]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (46) "tumor necrosis factor, alpha-induced protein 6"
Mouse Tumor necrosis factor-inducible gene 6 protein (TNFAIP6) ELISA kit; TSG-6; TSG6; hyaluronate-binding protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; tumor necrosis factor; alpha-induced protein 6
⇄products_gene_name => string (7) "TNFAIP6"
$value[3]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[3]['_source']['products_gene_name_syn']
⇄⧉products_description => string (743) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[3]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TNFAIP6 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TNFAIP6 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TNFAIP6 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TNFAIP6 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (676) "aaa18167 mouse this assay has high sensitivity and excellent specificity for...
$value[3]['_source']['search_terms']
aaa18167 mouse this assay has high sensitivity and excellent specificity for detection of tnfaip6 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18167_td elisa kit tumor necrosis factor alpha induced protein 6 inducible gene tsg tsg6 hyaluronate binding stimulated tnfip6 tnf 30,924 da tsg6_mouse 6678379 np_033424.1 o08859 nm_009398.2 samples serum plasma cell culture supernates tissue homogenates type quantitative sandwich range 62.5 pg ml 4000 < 15.6 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in protein6
⇄⧉specificity => string (189) "This assay has high sensitivity and excellent specificity for detection of h...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human c19orf59. No significant cross-reactivity or interference between human c19orf59 and analogues was observed.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[4]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[4]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[4]['_source']['products_weight']
⇄products_status => boolean true
$value[4]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[4]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[4]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[4]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[4]['_source']['language_id']
⇄products_name => string (47) "C1q and tumor necrosis factor related protein 6"
Human Complement C1q tumor necrosis factor-related protein 6 (C1QTNF6) ELISA kit; CTRP6; ZACRP6; complement-c1q tumor necrosis factor-related protein 6; C1q and tumor necrosis factor related protein 6
⇄products_gene_name => string (7) "C1QTNF6"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄⧉products_description => string (747) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[4]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for c19orf59 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any c19orf59 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for c19orf59 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of c19orf59 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Necrosis||4!!Diabetes Mellitus, Type 1||4!!Disease Models, Animal||2!!Inflam...
$value[4]['_source']['products_related_diseases']
Necrosis||4!!Diabetes Mellitus, Type 1||4!!Disease Models, Animal||2!!Inflammation||2!!Neovascularization, Pathologic||1!!Adenocarcinoma||1!!Breast Neoplasms||1!!Liver Neoplasms||1!!Carcinoma||1!!Carcinoma, Hepatocellular||1
⇄⧉search_terms => string (575) "aaa18089 human this assay has high sensitivity and excellent specificity for...
$value[4]['_source']['search_terms']
aaa18089 human this assay has high sensitivity and excellent specificity for detection of c19orf59 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18089_td elisa kit c1q tumor necrosis factor related protein 6 complement c1qtnf6 ctrp6 zacrp6 ctfp6 28,669 da unq581 pro1151 c1qt6_human 32967294 np_114116.3 q9bxi9 nm_031910.3 q5h9g8 q6zrm7 614910 samples serum plasma tissue homogenates cell lysates type quantitative sandwich range 62.5 pg ml 4000 15.6 intra precision within an cv protein6
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[5]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human SP-C. No significant cross-reactivity or interference between human SP-C and analogues was observed.
⇄purity => string (3) "N/A"
$value[5]['_source']['purity']
⇄form => string (3) "N/A"
$value[5]['_source']['form']
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[5]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (20) "surfactant protein C"
Human Pulmonary surfactant-associated protein C; SP-C ELISA Kit; PSP-C; SFTP2; SMDP2; SP-C; pulmonary surfactant apoprotein-2 SP-C; surfactant; pulmonary-associated protein C; surfactant protein C
⇄products_gene_name => string (5) "SFTPC"
$value[5]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[5]['_source']['products_gene_name_syn']
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[5]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for SP-C has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any SP-C present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for SP-C is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of SP-C bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (675) "aaa15287 human this assay has high sensitivity and excellent specificity for...
$value[5]['_source']['search_terms']
aaa15287 human this assay has high sensitivity and excellent specificity for detection of bovine sp c no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15287_td elisa kit surfactant protein pulmonary associated psp sftp2 smdp2 apoprotein 2 sftpc isoform proprotein bricd6 sp5 brichos domain containing 6 proteolipid spl val 21,053 da pspc_human 288915543 np_001165828.1 p11686 nm_001172357.1 p11687 q12793 q7z5d0 a6xne4 b2re00 e9pgx3 610913 samples serum plasma tissue homogenates type quantitative sandwich range 12.5 ng ml 800 3.12 intra precision within an cv apoprotein2 containing6 ml800
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.2-60ng/ml!!Sensitivity||0.14ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[6]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[6]['_source']['products_weight']
⇄products_status => boolean true
$value[6]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[6]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[6]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[6]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[6]['_source']['language_id']
⇄products_name => string (33) "Soluble Programmed Death 1 (SPD1)"
⇄⧉products_description => string (893) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[6]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human SPD1 antibody. SPD1 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human SPD1 Antibody is added and binds to SPD1 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated SPD1 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human SPD1. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human Soluble Programmed Death 1 (also known as SPD1) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[6]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[6]['_source']['products_categories']
⇄ncbi_full_name => string (4) "SPD1"
$value[6]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[6]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[6]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[6]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[6]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[6]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[6]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[6]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[6]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[6]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[6]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[6]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[6]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[6]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[6]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[6]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[6]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[6]['_source']['products_viewed']
⇄⧉search_terms => string (256) "aaa19040 human elisa kit soluble programmed death 1 spd1 1032289456 assay ty...
$value[6]['_source']['search_terms']
aaa19040 human elisa kit soluble programmed death 1 spd1 1032289456 assay type quantitative sandwich samples serum plasma cell culture supernates lysates tissue homogenates and other biological fluids detection range 0.2ng ml 60ng sensitivity 0.14ng death1
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of S...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SPD. No significant cross-reactivity or interference between SPD and analogues was observed.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[7]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
SPD (Pulmonary Surfactant Associated Protein D)/SFTPD/SP-D/Collectin 7/PSP-D/SFTP4/COLEC7/collectin-7/Lung surfactant protein D/PSPD/pulmonary surfactant-associated protein D/pulmonary surfactant apoprotein/surfactant protein D/surfactant; pulmonary-associated protein D/surfactant-associated protein; pulmonary 4
⇄products_gene_name => string (3) "SPD"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[7]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value[7]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[7]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[7]['_source']['products_categories']
⇄ncbi_full_name => string (41) "pulmonary surfactant-associated protein D"
$value[7]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (45) "mannose-binding lectin (protein C) 2, soluble"
⇄⧉search_terms => string (611) "aaa17316 human this assay has high sensitivity and excellent specificity for...
$value[7]['_source']['search_terms']
aaa17316 human this assay has high sensitivity and excellent specificity for detection of spd no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17316_sc elisa kit pulmonary surfactant associated protein d sftpd sp collectin 7 psp sftp4 colec7 lung pspd apoprotein 4 mannose binding lectin c 2 soluble mbl2 mbl1 cmbl 326633216 np_989680.2 nm_204349.2 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 1.563 100ng ml 0.938ng intra precision cv<8 inter cv<10 collectin7 apoprotein4 c2
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[8]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human PD-1. No significant cross-reactivity or interference between human PD-1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[8]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[8]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[8]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[8]['_source']['products_weight']
⇄products_status => boolean true
$value[8]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[8]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[8]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[8]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[8]['_source']['language_id']
⇄products_name => string (23) "programmed cell death 1"
Mouse Programmed Death 1 (PD-1) ELISA Kit; CD279; PD1; SLEB2; hPD-1; hPD-l; ; programmed cell death 1
⇄products_gene_name => string (5) "PDCD1"
$value[8]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[8]['_source']['products_gene_name_syn']
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[8]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for PD-1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PD-1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for PD-1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of PD-1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (624) "aaa15243 mouse this assay has high sensitivity and excellent specificity for...
$value[8]['_source']['search_terms']
aaa15243 mouse this assay has high sensitivity and excellent specificity for detection of human pd 1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15243_td elisa kit programmed cell death cd279 pd1 sleb2 hpd l pdcd1 protein pdc1 ly101 mpd 31,842 da cd_antigen pdcd1_mouse 6679239 np_032824.1 q02242 nm_008798.2 samples serum plasma tissue homogenates lysates type quantitative sandwich range 15.6 pg ml 1000 3.9 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in
⇄⧉specificity => string (385) "This assay has high sensitivity and excellent specificity for detection of C...
$value[9]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of C1QTNF6. No significant cross-reactivity or interference between C1QTNF6 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between C1QTNF6 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉etc_term1 => string (145) "Samples||Serum, plasma, cell culture supernatants, body fluid and tissue hom...
$value[9]['_source']['etc_term1']
Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Assay Type||Quantitative Competitive!!Sensitivity||0.1 ng/mL
⇄etc_term2 => string (3) "N/A"
$value[9]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[9]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[9]['_source']['products_weight']
⇄products_status => boolean true
$value[9]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[9]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[9]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[9]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[9]['_source']['language_id']
⇄products_name => string (64) "Complement C1q tumor necrosis factor related protein 6 (C1QTNF6)"
$value[9]['_source']['products_name']
⇄⧉products_name_oem => string (80) "Human Complement C1q tumor necrosis factor related protein 6 (C1QTNF6) ELISA...
$value[9]['_source']['products_name_oem']
Human Complement C1q tumor necrosis factor related protein 6 (C1QTNF6) ELISA Kit
⇄products_name_syn => string (3) "N/A"
$value[9]['_source']['products_name_syn']
⇄products_gene_name => string (7) "C1QTNF6"
$value[9]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[9]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1380) "Intended Uses: This C1QTNF6 ELISA kit is a 1.5 hour solid-phase ELISA design...
$value[9]['_source']['products_description']
Intended Uses: This C1QTNF6 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human C1QTNF6. This ELISA kit for research use only!<br><br>Principle of the Assay: C1QTNF6 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-C1QTNF6 antibody and an C1QTNF6-HRP conjugate. The assay sample and buffer are incubated together with C1QTNF6-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the C1QTNF6 concentration since C1QTNF6 from samples and C1QTNF6-HRP conjugate compete for the anti-C1QTNF6 antibody binding site. Since the number of sites is limited, as more sites are occupied by C1QTNF6 from the sample, fewer sites are left to bind C1QTNF6-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The C1QTNF6 concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Necrosis||4!!Diabetes Mellitus, Type 1||4!!Disease Models, Animal||2!!Inflam...
$value[9]['_source']['products_related_diseases']
Necrosis||4!!Diabetes Mellitus, Type 1||4!!Disease Models, Animal||2!!Inflammation||2!!Neovascularization, Pathologic||1!!Adenocarcinoma||1!!Breast Neoplasms||1!!Liver Neoplasms||1!!Carcinoma||1!!Carcinoma, Hepatocellular||1
⇄⧉search_terms => string (691) "aaa27081 human this assay has high sensitivity and excellent specificity for...
$value[9]['_source']['search_terms']
aaa27081 human this assay has high sensitivity and excellent specificity for detection of c1qtnf6 no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa27081_sc elisa kit complement c1q tumor necrosis factor related protein 6 ctfp6 ctrp6 zacrp6 17,720 da unq581 pro1151 c1qt6_human 32967300 np_872292.1 q9bxi9 nm_182486.1 q5h9g8 q6zrm7 614910 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 0.1 ng ml protein6 competitive0.1
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of P...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of PNKD. No significant cross-reactivity or interference between PNKD and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[10]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich ELISA, Double Antibody!!Samples||Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples!!Detection Range||0.156-10ng/ml!!Sensitivity||0.094ng/ml
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level PNKD were tested 20 times on one plate, respectively. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level PNKD were tested on 3 different plates, 8 replicates in each plate. CV (%) = SD/meanX100. Inter-Assay: CV<10%
⇄products_name_syn => string (65) "PNPLA6/NTE/Patatin-like phospholipase domain-containing protein 6"
$value[10]['_source']['products_name_syn']
⇄products_gene_name => string (6) "PNPLA6"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (833) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[10]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti-PNKD antibody was pre-coated onto 96-well plates. And the biotin conjugated anti-PNKD antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the PNKD amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of PNKD can be calculated.
⇄⧉search_terms => string (652) "aaa17309 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa17309 human this assay has high sensitivity and excellent specificity for detection of pnkd no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17309_sc elisa kit neuropathy target esterase pnpla6 nte patatin like phospholipase domain containing protein 6 samples serum plasma tissue homogenates other biological fluids type sandwich range 0.156 10ng ml <0.094ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv<8 inter assays different plates 8 replicates in each cv = sd meanx100 cv<10 protein6 an3 tested20 plates8
PRKCA; AAG6; MGC129900; MGC129901; PKC-alpha; PKCA; PRKACA; aging-associated gene 6; protein kinase C alpha type
⇄products_gene_name => string (5) "PRKCA"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1466) "Principle of the Assay: Human Protein kinase C alpha type (PRKCA) ELISA Kit ...
$value[11]['_source']['products_description']
Principle of the Assay: Human Protein kinase C alpha type (PRKCA) ELISA Kit employs a two-site sandwich ELISA to quantitate PRKCA in samples. An antibody specific for PRKCA has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PRKCA present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for PRKCA is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of PRKCA bound in the initial step. The color development is stopped and the intensity of the color is measured.<br><br>Background/Introduction: PRKCA, refers to both a human gene and the protein that is encoded by it. Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members.
⇄⧉search_terms => string (273) "aaa31487 human typical testing data standard curve for reference only aaa314...
$value[11]['_source']['search_terms']
aaa31487 human typical testing data standard curve for reference only aaa31487_sc elisa kit protein kinase c alpha type prkca aag6 mgc129900 mgc129901 pkc pkca prkaca aging associated gene 6 pkci+ pkcalpha a kpca_human 4506067 np_002728.1 p17252 176960 assay sandwich gene6
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human PD-1. No significant cross-reactivity or interference between human PD-1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[12]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[12]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[12]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[12]['_source']['products_weight']
⇄products_status => boolean true
$value[12]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[12]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[12]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[12]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[12]['_source']['language_id']
⇄products_name => string (23) "programmed cell death 1"
Human Programmed Death 1 (PD-1) ELISA KIT; CD279; PD1; SLEB2; hPD-1; hPD-l; ; programmed cell death 1
⇄products_gene_name => string (5) "PDCD1"
$value[12]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[12]['_source']['products_gene_name_syn']
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[12]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for PD-1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PD-1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for PD-1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of PD-1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (610) "aaa14992 human this assay has high sensitivity and excellent specificity for...
$value[12]['_source']['search_terms']
aaa14992 human this assay has high sensitivity and excellent specificity for detection of rat pct no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa14992_td elisa kit programmed cell death 1 pd cd279 pd1 sleb2 hpd l pdcd1 protein hsle1 systemic lupus erythematosus susceptibility 2 31,647 da cd_antigen pdcd1_human 167857792 np_005009.2 q15116 nm_005018.2 o00517 q8ix89 gene 605218 samples serum plasma tissue homogenates type quantitative sandwich range 31.25 pg ml 2000 7.8 intra precision within an cv death1 susceptibility2
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||20-3800ng/L!!Sensitivity||9.46ng/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[13]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[13]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[13]['_source']['products_weight']
⇄products_status => boolean true
$value[13]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[13]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[13]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[13]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[13]['_source']['language_id']
⇄products_name => string (34) "Cell death activator CIDE-3, CIDEC"
⇄⧉products_description => string (901) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[13]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human CIDEC antibody. CIDEC present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human CIDEC Antibody is added and binds to CIDEC in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated CIDEC antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human CIDEC. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human Cell death activator CIDE-3 (also known as CIDEC) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄ncbi_protein_info => string (27) "cell death activator CIDE-3"
$value[13]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[13]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (5) "63924"
$value[13]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[13]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (242) "Chylomicron-mediated Lipid Transport Pathway||1270006!!Lipid Digestion, Mobi...
$value[13]['_source']['ncbi_pathways']
Chylomicron-mediated Lipid Transport Pathway||1270006!!Lipid Digestion, Mobilization, And Transport Pathway||1270002!!Lipoprotein Metabolism Pathway||1270005!!Metabolism Pathway||1269956!!Metabolism Of Lipids And Lipoproteins Pathway||1270001
⇄sp_protein_name => string (27) "Cell death activator CIDE-3"
$value[13]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (84) "Cell death-inducing DFFA-like effector protein C; Fat-specific protein FSP27...
$value[13]['_source']['sp_protein_name_syn']
Cell death-inducing DFFA-like effector protein C; Fat-specific protein FSP27 homolog
⇄⧉search_terms => string (548) "aaa19063 human typical testing data standard curve for reference only aaa190...
$value[13]['_source']['search_terms']
aaa19063 human typical testing data standard curve for reference only aaa19063_sc elisa kit cell death activator cide 3 cidec isoform 4 inducing dffa like effector c cide3 fpld5 fsp27 protein fat specific homolog cidec_human 1007383418 q96aq7 np_001308073.1 612120 samples serum plasma culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 20 3800ng l sensitivity 9.46ng intra precision within an three of known concentration were tested on one plate to assess cv isoform4 range20
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of B...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of BCL6. No significant cross-reactivity or interference between BCL6 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between BCL6 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 pg/mL
⇄etc_term2 => string (3) "N/A"
$value[14]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[14]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[14]['_source']['products_weight']
⇄products_status => boolean true
$value[14]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[14]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[14]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[14]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[14]['_source']['language_id']
⇄products_name => string (32) "B cell lymphoma 6 protein (BCL6)"
$value[14]['_source']['products_name']
⇄products_name_oem => string (48) "Human B cell lymphoma 6 protein (BCL6) ELISA Kit"
$value[14]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[14]['_source']['products_name_syn']
⇄products_gene_name => string (4) "BCL6"
$value[14]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[14]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1389) "Principle of the Assay: BCL6 ELISA kit applies the competitive enzyme immuno...
$value[14]['_source']['products_description']
Principle of the Assay: BCL6 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-BCL6 antibody and an BCL6-HRP conjugate. The assay sample and buffer are incubated together with BCL6-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the BCL6 concentration since BCL6 from samples and BCL6-HRP conjugate compete for the anti-BCL6 antibody binding site. Since the number of sites is limited, as more sites are occupied by BCL6 from the sample, fewer sites are left to bind BCL6-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The BCL6 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This BCL6 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human BCL6. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
B Cell Receptor Signaling Pathway||198909!!DNA Damage Response (only ATM Dependent) Pathway||198827!!Direct P53 Effectors Pathway||137939!!FoxO Family Signaling Pathway||138036!!FoxO Signaling Pathway||921162!!IL4-mediated Signaling Events Pathway||137933!!Signaling Events Mediated By HDAC Class II Pathway||138062!!Transcriptional Misregulation In Cancer Pathway||523016!!Transcriptional Misregulation In Cancer Pathway||522987
⇄products_name => string (31) "Programmed cell death protein 1"
$value[15]['_source']['products_name']
⇄products_name_oem => string (47) "Human Programmed cell death protein 1 ELISA Kit"
$value[15]['_source']['products_name_oem']
⇄products_name_syn => string (71) "Programmed cell death protein 1; Protein PD-1; hPD-1; PDCD1; PD1; CD279"
$value[15]['_source']['products_name_syn']
⇄products_gene_name => string (5) "PDCD1"
$value[15]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[15]['_source']['products_gene_name_syn']
⇄⧉products_description => string (208) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[15]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates?cell culture supernates or other biological fluids.
⇄⧉search_terms => string (418) "aaa23165 human recombinant and natural hpd 1 typical testing data standard c...
$value[15]['_source']['search_terms']
aaa23165 human recombinant and natural hpd 1 typical testing data standard curve for reference only aaa23165_sc elisa kit programmed cell death protein pd pdcd1 pd1 cd279 sleb2 l hsle1 31,647 da cd_antigen pdcd1_human 167857792 np_005009.2 q15116 nm_005018.2 o00517 q8ix89 109100 samples serum plasma tissue homogenates?cell culture supernates or other biological fluids detection range 0.156 10 ng ml sensitivity hpd1
⇄⧉storage_stability => string (202) "For unopened kit, all reagents should be kept according to the labels on via...
$value[16]['_source']['storage_stability']
For unopened kit, all reagents should be kept according to the labels on vials. The TMB Substrate, Wash Buffer, Stop Solution should be stored at 4 degree C. All others should be stored at -20 degree C.
⇄⧉search_terms => string (580) "aaa13932 human typical testing data standard curve for reference only aaa139...
$value[16]['_source']['search_terms']
aaa13932 human typical testing data standard curve for reference only aaa13932_td elisa kit mannose receptor c type 2 mrc2 pkc2 pkc z prkcz protein kinase m zeta cd280 uparap clec13e endo180 166,674 da lectin domain family 13 member e endocytic 180 macrophage urokinase plasminogen activator associated upar cd_antigen kiaa0709 110624774 np_006030.2 q9ubg0 nm_006039.4 q7lge7 q9y5p9 a6h8k4 d3du08 af107292 mrna samples serum plasma tissue homogenates and other biological fluids assay sandwich detection range 0.312 20ng ml sensitivity 0.117ng intra cv type2 family13 endocytic180
⇄⧉products_description => string (1368) "Intended Uses: This CHRNA1 ELISA kit is a 1.5 hour solid-phase ELISA designe...
$value[17]['_source']['products_description']
Intended Uses: This CHRNA1 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Canine CHRNA1. This ELISA kit for research use only!<br><br>Principle of the Assay: CHRNA1 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-CHRNA1 antibody and an CHRNA1-HRP conjugate. The assay sample and buffer are incubated together with CHRNA1-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the CHRNA1 concentration since CHRNA1 from samples and CHRNA1-HRP conjugate compete for the anti-CHRNA1 antibody binding site. Since the number of sites is limited, as more sites are occupied by CHRNA1 from the sample, fewer sites are left to bind CHRNA1-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The CHRNA1 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (493) "aaa17148 chicken typical testing data standard curve for reference only aaa1...
$value[17]['_source']['search_terms']
aaa17148 chicken typical testing data standard curve for reference only aaa17148_sc elisa kit cell death inducing dff45 like effector cidec fsp27 activator cide 3 isoform 1 dffa c cide3 fpld5 fat specific protein 27 26,754 da homolog cidec_human 313850983 np_001186552 q96aq7 nm_001199623.1 q67dw9 q9gzy9 c9jmn7 612120 biology samples serum plasma culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 1.0 pg ml isoform1 protein27 sensitivity1.0
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of r...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat TSG-6. No significant cross-reactivity or interference between rat TSG-6 and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[18]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
Rat tumor necrosis factor-inducible gene 6 protein (TSG-6) elisa kit; TSG-6; TSG6; hyaluronate-binding protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; tumor necrosis factor-inducible gene 6 protein (TSG-6)
⇄products_gene_name => string (5) "TSG-6"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[18]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TSG-6 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TSG-6 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TSG-6 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TSG-6 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (660) "aaa15810 rat this assay has high sensitivity and excellent specificity for d...
$value[18]['_source']['search_terms']
aaa15810 rat this assay has high sensitivity and excellent specificity for detection of tsg 6 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15810_td elisa kit tumor necrosis factor inducible gene protein tsg6 hyaluronate binding alpha stimulated tnfaip6 tnf induced ps4 secreted 31,081 da tsg6_rabit 126722863 np_001075780.1 p98065 nm_001082311.1 samples serum plasma tissue homogenates type quantitative sandwich range 0.312 ng ml 20 < 0.078 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml20
⇄⧉etc_term1 => string (140) "Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative...
$value[19]['_source']['etc_term1']
Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||0.31-20ng/mL!!Sensitivity||0.19ng/mL
⇄⧉etc_term2 => string (372) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, mid range and high level Human LRP6 were tested 20 times on one plate, respectively.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, mid range and high level Human LRP6 were tested on 3 different plates, 20 replicates in each plate.
⇄products_price => string (6) "0.0000"
$value[19]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[19]['_source']['products_weight']
⇄products_status => boolean true
$value[19]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[19]['_source']['products_tax_class_id']
⇄manufacturers_id => string (4) "2500"
$value[19]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[19]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[19]['_source']['language_id']
⇄products_name => string (4) "LRP6"
$value[19]['_source']['products_name']
⇄products_name_oem => string (71) "Human LRP6 (Low Density Lipoprotein Receptor Related Protein) ELISA Kit"
$value[19]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[19]['_source']['products_name_syn']
⇄products_gene_name => string (4) "LRP6"
$value[19]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[19]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1213) "Intended Uses: This ELISA kit applies to the in vitro quantitative determina...
$value[19]['_source']['products_description']
Intended Uses: This ELISA kit applies to the in vitro quantitative determination of Human LRP6 concentrations in serum, plasma and other biological fluids.<br><br>Principle of the Assay: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human LRP6. Standards or samples are added to the micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for Human LRP6 and Avidin-Horseradish Peroxidase (HRP) conjugate are added successively to each micro plate well and incubated. Free components are washed away. The substrate solution is added to each well. Only those wells that contain Human LRP6, biotinylated detection antibody and Avidin-HRP conjugate will appear blue in color. The enzyme-substrate reaction is terminated by the addition of stop solution and the color turns yellow. The optical density (OD) is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The OD value is proportional to the concentration of Human LRP6. You can calculate the concentration of Human LRP6 in the samples by comparing the OD of the samples to the standard curve.
Canonical Wnt Signaling Pathway||138032!!Disease Pathway||530764!!MicroRNAs In Cardiomyocyte Hypertrophy Pathway||198784!!Presenilin Action In Notch And Wnt Signaling Pathway||137914!!RNF Mutants Show Enhanced WNT Signaling And Proliferation Pathway||1127632!!Signal Transduction Pathway||477114!!Signaling By WNT In Cancer Pathway||1127614!!Signaling By Wnt Pathway||106510!!TCF Dependent Signaling In Response To WNT Pathway||1127516!!Wnt Signaling Pathway NetPath||198799
⇄sp_protein_name => string (50) "Low-density lipoprotein receptor-related protein 6"
⇄⧉search_terms => string (626) "aaa21583 human this kit recognizes lrp6 in samples no significant cross reac...
$value[19]['_source']['search_terms']
aaa21583 human this kit recognizes lrp6 in samples no significant cross reactivity or interference between and analogues was observed typical testing data standard curve for reference only aaa21583_td elisa low density lipoprotein receptor related protein 6 adcad2 lrp 180,429 da lrp6_human 148727288 np_002327.2 o75581 nm_002336.2 q17rz2 603507 serum plasma other biological fluids assay type quantitative sandwich detection range 0.31 20ng ml sensitivity 0.19ng intra precision within an 3 with mid high level were tested 20 times on one plate respectively inter assays different plates replicates each protein6 an3 tested20
