Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR2C2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit NR2C2 Polyclonal Antibody | anti-NR2C2 antibody

NR2C2 antibody - N-terminal region

Gene Names
NR2C2; TR4; TAK1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NR2C2; Polyclonal Antibody; NR2C2 antibody - N-terminal region; anti-NR2C2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVIL
Sequence Length
615
Applicable Applications for anti-NR2C2 antibody
Western Blot (WB)
Homology
Cow: 88%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2C2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR2C2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-NR2C2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-NR2C2 antibody
This is a rabbit polyclonal antibody against NR2C2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996 [PubMed 8661150]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
nuclear receptor subfamily 2 group C member 2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 2 group C member 2
NCBI Official Symbol
NR2C2
NCBI Official Synonym Symbols
TR4; TAK1
NCBI Protein Information
nuclear receptor subfamily 2 group C member 2
UniProt Protein Name
Nuclear receptor subfamily 2 group C member 2
UniProt Gene Name
NR2C2
UniProt Synonym Gene Names
TAK1; TR4
UniProt Entry Name
NR2C2_HUMAN

NCBI Description

This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]

Uniprot Description

NR2C2: Orphan nuclear receptor that can act as a repressor or activator of transcription. An important repressor of nuclear recptor signaling pathways such as retinoic acid receptor, retinoid X, vitamin D3 receptor, thyroid hormone receptor and estrogen receptor pathways. May regulate gene expression during the late phase of spermatogenesis. Together with NR2C1, forms the core of the DRED (direct repeat erythroid-definitive) complex that represses embryonic and fetal globin transcription including that of GATA1. Binds to hormone response elements (HREs) consisting of two 5'-AGGTCA-3' half site direct repeat consensus sequences. Plays a fundamental role in early embryonic development and embryonic stem cells. Required for normal spermatogenesis and cerebellum development. Appears to be important for neurodevelopmentally regulated behavior. Activates transcriptional activity of LHCG. Antagonist of PPARA-mediated transactivation. Belongs to the nuclear hormone receptor family. NR2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; Nuclear receptor

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: nucleoplasm

Molecular Function: protein binding; zinc ion binding; protein heterodimerization activity; sequence-specific DNA binding; transcription coactivator activity; steroid hormone receptor activity; receptor activity; transcription factor activity

Biological Process: nervous system development; transcription initiation from RNA polymerase II promoter; positive regulation of embryonic development; regulation of transcription, DNA-dependent; meiotic cell cycle; positive regulation of behavior; cerebellum development; steroid hormone mediated signaling; gene expression; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter; cell differentiation

Research Articles on NR2C2

Similar Products

Product Notes

The NR2C2 nr2c2 (Catalog #AAA3204004) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR2C2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NR2C2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR2C2 nr2c2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTSLNKEKIV TDQQTGQKIQ IVTAVDASGS PKQQFILTSP DGAGTGKVIL. It is sometimes possible for the material contained within the vial of "NR2C2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.