Mouse anti-Human NFATC3 Monoclonal Antibody | anti-NFATC3 antibody

NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (FITC)

Cat. Num. AAA6148467

• Gene Names: NFATC3; NFAT4; NFATX; NF-AT4c
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NFATC3; Monoclonal Antibody; NFATC3 (Nuclear Factor of Activated T-cells; Cytoplasmic 3; NF-ATc3; NFATc3; NFATx; T-cell Transcription Factor NFAT4; NF-AT4; NFAT4) (FITC); anti-NFATC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3A12
• Specificity: Recognizes human NFATC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1075

• Applicable Applications for anti-NFATC3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa70-150 from human NFATC3 (NP_775188) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to NFATC3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NFATC3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NFATC3 is ~10ng/ml as a capture antibody.)

Product Categories/Family for anti-NFATC3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 27886561
• NCBI GeneID: 4775
• NCBI Accession #: NP_775188
• NCBI GenBank Nucleotide #: NM_173165
• UniProt Accession #: Q12968
• NCBI Official Full Name: nuclear factor of activated T-cells, cytoplasmic 3 isoform 1
• NCBI Official Synonym Full Names: nuclear factor of activated T cells 3
• NCBI Official Symbol: NFATC3
• NCBI Official Synonym Symbols: NFAT4; NFATX; NF-AT4c
• NCBI Protein Information: nuclear factor of activated T-cells, cytoplasmic 3
• UniProt Protein Name: Nuclear factor of activated T-cells, cytoplasmic 3
• Protein Family: Nuclear factor of activated T-cells
• UniProt Gene Name: NFATC3
• UniProt Synonym Gene Names: NFAT4; NF-ATc3; NFATc3; NF-AT4
• UniProt Entry Name: NFAC3_HUMAN

NCBI Description

The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

NFAT4: a transcription factor that plays a role in the inducible expression of cytokine genes in T cells. Plays a role in the regulation of gene expression in T cells and immature thymocytes. Six spliced isoforms have been identified. Isoform 1 is predominantly expressed in thymus, peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: protein binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; heart development; cellular respiration; muscle cell development; innate immune response; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; inflammatory response