Mouse anti-Human NFATC3 Monoclonal Antibody | anti-NFATC3 antibody

NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) APC

Cat. Num. AAA6137861

• Gene Names: NFATC3; NFAT4; NFATX; NF-AT4c
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NFATC3; Monoclonal Antibody; NFATC3 (Nuclear Factor of Activated T-cells; Cytoplasmic 3; NF-ATc3; NFATc3; NFATx; T-cell Transcription Factor NFAT4; NF-AT4; NFAT4) APC; anti-NFATC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3A12
• Specificity: Recognizes human NFATC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1075

• Applicable Applications for anti-NFATC3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa70-150 from human NFATC3 (NP_775188) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to NFATC3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NFATC3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NFATC3 is ~10ng/ml as a capture antibody.)

Product Categories/Family for anti-NFATC3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 27886561
• NCBI GeneID: 4775
• NCBI Accession #: NP_775188
• NCBI GenBank Nucleotide #: NM_173165
• UniProt Accession #: Q12968
• NCBI Official Full Name: nuclear factor of activated T-cells, cytoplasmic 3 isoform 1
• NCBI Official Synonym Full Names: nuclear factor of activated T cells 3
• NCBI Official Symbol: NFATC3
• NCBI Official Synonym Symbols: NFAT4; NFATX; NF-AT4c
• NCBI Protein Information: nuclear factor of activated T-cells, cytoplasmic 3
• UniProt Protein Name: Nuclear factor of activated T-cells, cytoplasmic 3
• Protein Family: Nuclear factor of activated T-cells
• UniProt Gene Name: NFATC3
• UniProt Synonym Gene Names: NFAT4; NF-ATc3; NFATc3; NF-AT4
• UniProt Entry Name: NFAC3_HUMAN

NCBI Description

The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

NFAT4: a transcription factor that plays a role in the inducible expression of cytokine genes in T cells. Plays a role in the regulation of gene expression in T cells and immature thymocytes. Six spliced isoforms have been identified. Isoform 1 is predominantly expressed in thymus, peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: protein binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; heart development; cellular respiration; muscle cell development; innate immune response; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; inflammatory response