Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MMS19 expression in transfected 293T cell line by MMS19 polyclonal antibody. Lane 1: MMS19L transfected lysate (32.34kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human MMS19 Polyclonal Antibody | anti-MMS19 antibody

MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog, hMMS19, MET18 Homolog, MMS19-like Protein, MMS19L, FLJ34167, FLJ95146, MGC99604)

Gene Names
MMS19; MET18; MMS19L; hMMS19
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MMS19; Polyclonal Antibody; MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog; hMMS19; MET18 Homolog; MMS19-like Protein; MMS19L; FLJ34167; FLJ95146; MGC99604); Anti -MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog; anti-MMS19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MMS19.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
Applicable Applications for anti-MMS19 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human MMS19, aa1-294 (AAH07298).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MMS19 expression in transfected 293T cell line by MMS19 polyclonal antibody. Lane 1: MMS19L transfected lysate (32.34kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MMS19 expression in transfected 293T cell line by MMS19 polyclonal antibody. Lane 1: MMS19L transfected lysate (32.34kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to MMS19 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to MMS19 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-MMS19 antibody
Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into apoproteins specifically involved in DNA metabolism and genomic integrity. In the CIA complex, MMS19 acts as an adapter between early-acting CIA components and a subset of cellular target iron-sulfur proteins such as ERCC2/XPD, FANCJ and RTEL1, thereby playing a key role in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription. As part of the mitotic spindle-associated MMXD complex, plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD. Indirectly acts as a transcriptional coactivator of estrogen receptor (ER), via its role in iron-sulfur insertion into some component of the TFIIH-machinery.
Product Categories/Family for anti-MMS19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
113,290 Da
NCBI Official Full Name
MMS19 nucleotide excision repair protein homolog
NCBI Official Synonym Full Names
MMS19 nucleotide excision repair homolog (S. cerevisiae)
NCBI Official Symbol
MMS19
NCBI Official Synonym Symbols
MET18; MMS19L; hMMS19
NCBI Protein Information
MMS19 nucleotide excision repair protein homolog; MET18 homolog; MMS19-like protein; homolog of yeast MMS19; MMS19-like (MET18 homolog, S. cerevisiae)
UniProt Protein Name
MMS19 nucleotide excision repair protein homolog
UniProt Gene Name
MMS19
UniProt Synonym Gene Names
MMS19L; hMMS19
UniProt Entry Name
MMS19_HUMAN

Uniprot Description

Function: Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into apoproteins specifically involved in DNA metabolism and genomic integrity. In the CIA complex, MMS19 acts as an adapter between early-acting CIA components and a subset of cellular target iron-sulfur proteins such as ERCC2/XPD, FANCJ and RTEL1, thereby playing a key role in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription. As part of the mitotic spindle-associated MMXD complex, plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD. Indirectly acts as a transcriptional coactivator of estrogen receptor (ER), via its role in iron-sulfur insertion into some component of the TFIIH-machinery. Ref.1 Ref.3 Ref.11 Ref.14 Ref.15

Subunit structure: Component of the CIA complex. Component of the MMXD complex, composed of CIAO1, ERCC2, FAM96B, MMS19 and SLC25A5. Interacts with FAM96B; the interaction is direct. Interacts with ERCC2/XPD; the interaction is direct. Interacts with ERCC3/XPB and NCOA3/RAC3. Ref.1 Ref.2 Ref.11 Ref.14 Ref.15

Subcellular location: Nucleus. Cytoplasm › cytoskeleton › spindle Ref.1 Ref.2 Ref.3 Ref.11 Ref.15.

Tissue specificity: Ubiquitously expressed with higher expression in testis. Ref.1 Ref.3

Sequence similarities: Belongs to the MET18/MMS19 family.Contains 7 HEAT repeats.

Sequence caution: The sequence AAH80532.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence BAB55315.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BAB71223.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.The sequence BAG51657.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAC29239.1 differs from that shown. Reason: Frameshift at positions 373 and 412.

Research Articles on MMS19

Similar Products

Product Notes

The MMS19 mms19 (Catalog #AAA646721) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog, hMMS19, MET18 Homolog, MMS19-like Protein, MMS19L, FLJ34167, FLJ95146, MGC99604) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMS19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the MMS19 mms19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRELLELSCC HSCPFSSTAA AKCFAGLLNK HPAGQQLDEF LQLAVDKVEA GLGSGPCRSQ AFTLLLWVTK ALVLRYHPLS SCLTARLMGL LSDPELGPAA ADGFSLLMSD CTDVLTRAGH AEVRIMFRQR FFTDNVPALV QGFHAAPPDV KPNYLKGLSH VLNRLPKPVL LPELPTLLSL LLEALSCPDC VVQLSTLSCL QPLLLEAPQV MSLHVDTLVT KFLNLSSSPS MAVRIAALQC MHALTRLPTP VLLPYKPQVI RALAKSLDDK KRLVRKEAVS ARGEWFLLGS PGS. It is sometimes possible for the material contained within the vial of "MMS19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.