Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to NFATC3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Mouse anti-Human NFATC3 Monoclonal Antibody | anti-NFATC3 antibody

NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (HRP)

Gene Names
NFATC3; NFAT4; NFATX; NF-AT4c
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NFATC3; Monoclonal Antibody; NFATC3 (Nuclear Factor of Activated T-cells; Cytoplasmic 3; NF-ATc3; NFATc3; NFATx; T-cell Transcription Factor NFAT4; NF-AT4; NFAT4) (HRP); anti-NFATC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A12
Specificity
Recognizes human NFATC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1075
Applicable Applications for anti-NFATC3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa70-150 from human NFATC3 (NP_775188) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to NFATC3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to NFATC3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NFATC3 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NFATC3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NFATC3 is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NFATC3 is ~10ng/ml as a capture antibody.)
Product Categories/Family for anti-NFATC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nuclear factor of activated T-cells, cytoplasmic 3 isoform 1
NCBI Official Synonym Full Names
nuclear factor of activated T cells 3
NCBI Official Symbol
NFATC3
NCBI Official Synonym Symbols
NFAT4; NFATX; NF-AT4c
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 3
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 3
UniProt Gene Name
NFATC3
UniProt Synonym Gene Names
NFAT4; NF-ATc3; NFATc3; NF-AT4
UniProt Entry Name
NFAC3_HUMAN

NCBI Description

The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

NFAT4: a transcription factor that plays a role in the inducible expression of cytokine genes in T cells. Plays a role in the regulation of gene expression in T cells and immature thymocytes. Six spliced isoforms have been identified. Isoform 1 is predominantly expressed in thymus, peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, heart, placenta and pancreas. Isoform 3 is expressed in thymus and kidney. Isoform 4 is expressed in thymus and skeletal muscle.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: protein binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; heart development; cellular respiration; muscle cell development; innate immune response; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; inflammatory response

Research Articles on NFATC3

Similar Products

Product Notes

The NFATC3 nfatc3 (Catalog #AAA6153770) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFATC3 nfatc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFATC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.