Mouse anti-Human NELL2 Monoclonal Antibody | anti-NELL2 antibody

NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91) (HRP)

Cat. Num. AAA6153756

• Gene Names: NELL2; NRP2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NELL2; Monoclonal Antibody; NELL2 (Protein Kinase C-binding Protein NELL2; MEL91 Protein; NEL-like Protein 2; Mel91) (HRP); anti-NELL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F6
• Specificity: Recognizes human NELL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NELL2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa301-400 from human NELL2 (NP_006150) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged NELL2 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-NELL2 antibody

Protein kinase C-binding protein, NELL2 is expressed abundantly in neural tissues and may play important roles in the development of neural tissues. Also, NELL protein contains six epidermal growth factor (EGF)-like repeat domains that participate in calcium binding.

Product Categories/Family for anti-NELL2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5453766
• NCBI GeneID: 4753
• NCBI Accession #: NP_006150
• NCBI GenBank Nucleotide #: NM_006159
• UniProt Accession #: Q99435; Q96JS2; B7Z2U7; B7Z5Q4; B7Z9J5; B7Z9U3
• Molecular Weight: 91,167 Da
• NCBI Official Full Name: protein kinase C-binding protein NELL2 isoform b
• NCBI Official Synonym Full Names: neural EGFL like 2
• NCBI Official Symbol: NELL2
• NCBI Official Synonym Symbols: NRP2
• NCBI Protein Information: protein kinase C-binding protein NELL2
• UniProt Protein Name: Protein kinase C-binding protein NELL2
• Protein Family: Protein kinase C-binding protein
• UniProt Gene Name: NELL2
• UniProt Synonym Gene Names: NRP2

NCBI Description

The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. [provided by RefSeq, Feb 2009]

Uniprot Description

Required for neuron survival through the modulation of MAPK pathways (). Involved in the regulation of hypothalamic GNRH secretion and the control of puberty ().