Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NEK4 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human NEK4 Monoclonal Antibody

NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2, MGC33171)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NEK4; Monoclonal Antibody; NEK4 (Never in Mitosis A-related Kinase 4; NimA-related Protein Kinase 4; NRK2; pp12301; Serine/threonine Protein Kinase 2; STK2; Serine/threonine Protein Kinase Nek4; Serine/threonine Protein Kinase NRK2; MGC33171); Anti -NEK4 (Never in Mitosis A-related Kinase 4; anti-NEK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B8
Specificity
Recognizes human NEK4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF
Applicable Applications for anti-NEK4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa680-781 from human NEK4 (AAH63044) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NEK4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NEK4 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-NEK4 antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The STE group (homologs of yeast Sterile 7, 11, 20 kinases) consists of 50 kinases related to the mitogen-activated protein kinase (MAPK) cascade families (Ste7/MAP2K, Ste11/MAP3K, and Ste20/MAP4K). MAP kinase cascades, consisting of a MAPK and one or more upstream regulatory kinases (MAPKKs) have been best characterized in the yeast pheromone response pathway. Pheromones bind to Ste cell surface receptors and activate yeast MAPK pathway.
Product Categories/Family for anti-NEK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Nek4

Similar Products

Product Notes

The NEK4 (Catalog #AAA648877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEK4 (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2, MGC33171) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the NEK4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DVPVANPVSE FKLHRKYRDT LILHGKVAEE AEEIHFKELP SAIMPGSEKI RRLVEVLRTD VIRGLGVQLL EQVYDLLEEE DEFDREVSVS LTVSRCLCYR IF. It is sometimes possible for the material contained within the vial of "NEK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.