Mouse anti-Human Probable Tubulin Polyglutamylase TTLL1 Monoclonal Antibody | anti-TTLL1 antibody

Probable Tubulin Polyglutamylase TTLL1 (Tubulin--tyrosine Ligase-like Protein 1, TTLL1, Tubulin Polyglutamylase Complex Subunit 3, PGs3, C22orf7, HS323M22B)

Cat. Num. AAA644466

• Gene Names: TTLL1; C22orf7; HS323M22B
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: Probable Tubulin Polyglutamylase TTLL1; Monoclonal Antibody; Probable Tubulin Polyglutamylase TTLL1 (Tubulin--tyrosine Ligase-like Protein 1; TTLL1; Tubulin Polyglutamylase Complex Subunit 3; PGs3; C22orf7; HS323M22B); Anti -Probable Tubulin Polyglutamylase TTLL1 (Tubulin--tyrosine Ligase-like Protein 1; anti-TTLL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C6
• Specificity: Recognizes human TTLL1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAGKVKWVTDIEKSVLINNFEKRGWVQVTENEDWNFYWMSVQTIRNVFSVEAGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPLAEKDENGKYLYLDFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSSFVSQSNKEAYVISLYINNPLLIGGRKFDLRLYVLVSTYRPLRCYMYKLGFCRFCTVKYTPSTSELDNMFVHPTNVAIQKHGEDYNHI

• Applicable Applications for anti-TTLL1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full-length recombinant protein corresponding to aa1-424 from TTLL1 (AAH14968) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TTLL1 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-TTLL1 antibody

Antibodies; Abs to Tubulin

NCBI and Uniprot Product Information

• NCBI GI #: 11068135
• NCBI GeneID: 25809
• NCBI Accession #: NP_036395.1
• NCBI GenBank Nucleotide #: NM_012263.4
• UniProt Accession #: O95922; Q9BR27; Q9NRS9; Q9UMU0; B2RDS7
• Molecular Weight: 48,988 Da
• NCBI Official Full Name: probable tubulin polyglutamylase TTLL1
• NCBI Official Synonym Full Names: tubulin tyrosine ligase-like family, member 1
• NCBI Official Symbol: TTLL1
• NCBI Official Synonym Symbols: C22orf7; HS323M22B
• NCBI Protein Information: probable tubulin polyglutamylase TTLL1; PGs3; tubulin-tyrosine ligase; tubulin--tyrosine ligase-like protein 1; tubulin polyglutamylase complex subunit 3; catalytic subunit of neural tubulin polyglutamylase
• UniProt Protein Name: Probable tubulin polyglutamylase TTLL1
• Protein Family: Probable tubulin polyglutamylase
• UniProt Gene Name: TTLL1
• UniProt Synonym Gene Names: C22orf7; PGs3
• UniProt Entry Name: TTLL1_HUMAN

Uniprot Description

TTLL1: Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. Belongs to the tubulin polyglutamylase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Cell cycle regulation; EC 6.-.-.-; Microtubule-binding

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: microtubule; cytoplasm

Biological Process: protein polyglutamylation; axoneme biogenesis