Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52KD).)

Mouse anti-Human NCBP1 Monoclonal Antibody | anti-NCBP1 antibody

NCBP1 (Nuclear Cap-binding Protein Subunit 1, 80kD Nuclear Cap-binding Protein, CBP80, NCBP 80kD Subunit, CBP80, NCBP, MGC2087) (PE)

Gene Names
NCBP1; NCBP; Sto1; CBP80
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NCBP1; Monoclonal Antibody; NCBP1 (Nuclear Cap-binding Protein Subunit 1; 80kD Nuclear Cap-binding Protein; CBP80; NCBP 80kD Subunit; NCBP; MGC2087) (PE); anti-NCBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E9
Specificity
Recognizes human NCBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NCBP1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-99 from human NCBP1 (NP_002477) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52KD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52KD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NCBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NCBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])
Product Categories/Family for anti-NCBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 87 kDa

Observed: 87 kDa
NCBI Official Full Name
nuclear cap-binding protein subunit 1
NCBI Official Synonym Full Names
nuclear cap binding protein subunit 1, 80kDa
NCBI Official Symbol
NCBP1
NCBI Official Synonym Symbols
NCBP; Sto1; CBP80
NCBI Protein Information
nuclear cap-binding protein subunit 1; NCBP 80 kDa subunit; 80 kDa nuclear cap-binding protein; nuclear cap binding protein subunit 1, 80kD
UniProt Protein Name
Nuclear cap-binding protein subunit 1
UniProt Gene Name
NCBP1
UniProt Synonym Gene Names
CBP80; NCBP; CBP80
UniProt Entry Name
NCBP1_HUMAN

NCBI Description

The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. [provided by RefSeq, Jul 2008]

Uniprot Description

NCBP1: mediates U snRNA export from the nucleus. Binds to 5' capped mRNA. Found in aU snRNA export complex with RNUXA/PHAX, CBP20, CBP80, RAN, XPO1 and m7G-capped RNA. Interaction with RNUXA/PHAX. Heterodimer with NCBP2. Is part of the exon junction complex (EJC) containing NCBP1, NCBP2, RNPS1, RBM8A, SRRM1, NXF1, UPF3B, UPF2, THOC4 and/or REFBP2.

Protein type: Translation; Spliceosome; RNA processing

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: nucleoplasm; mRNA cap complex; mitochondrion; cytoplasm; nucleus; cytosol; ribonucleoprotein complex

Molecular Function: protein binding; RNA binding; RNA cap binding

Biological Process: transcription from RNA polymerase II promoter; spliceosomal snRNP biogenesis; viral reproduction; positive regulation of viral transcription; RNA splicing; histone mRNA metabolic process; positive regulation of mRNA 3'-end processing; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; mRNA capping; RNA elongation from RNA polymerase II promoter; mRNA catabolic process, nonsense-mediated decay; RNA-mediated gene silencing; gene expression; nuclear mRNA cis splicing, via U2-type spliceosome; mRNA 3'-end processing; termination of RNA polymerase II transcription; mRNA cleavage; regulation of translational initiation

Research Articles on NCBP1

Similar Products

Product Notes

The NCBP1 ncbp1 (Catalog #AAA6159012) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCBP1 (Nuclear Cap-binding Protein Subunit 1, 80kD Nuclear Cap-binding Protein, CBP80, NCBP 80kD Subunit, CBP80, NCBP, MGC2087) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCBP1 ncbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.