Mouse anti-Human NCBP1 Monoclonal Antibody | anti-NCBP1 antibody

NCBP1 (Nuclear Cap-binding Protein Subunit 1, 80kD Nuclear Cap-binding Protein, CBP80, NCBP 80kD Subunit, CBP80, NCBP, MGC2087) (HRP)

Cat. Num. AAA6153709

• Gene Names: NCBP1; NCBP; Sto1; CBP80
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NCBP1; Monoclonal Antibody; NCBP1 (Nuclear Cap-binding Protein Subunit 1; 80kD Nuclear Cap-binding Protein; CBP80; NCBP 80kD Subunit; NCBP; MGC2087) (HRP); anti-NCBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1E9
• Specificity: Recognizes human NCBP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NCBP1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-99 from human NCBP1 (NP_002477) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52KD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NCBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Product Categories/Family for anti-NCBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4505343
• NCBI GeneID: 4686
• NCBI Accession #: NP_002477
• NCBI GenBank Nucleotide #: NM_002486
• UniProt Accession #: Q09161; Q59G76; Q5T1V0; Q5T7X2; B2R718
• Molecular Weight: Predicted: 87 kDa; ; Observed: 87 kDa
• NCBI Official Full Name: nuclear cap-binding protein subunit 1
• NCBI Official Synonym Full Names: nuclear cap binding protein subunit 1, 80kDa
• NCBI Official Symbol: NCBP1
• NCBI Official Synonym Symbols: NCBP; Sto1; CBP80
• NCBI Protein Information: nuclear cap-binding protein subunit 1; NCBP 80 kDa subunit; 80 kDa nuclear cap-binding protein; nuclear cap binding protein subunit 1, 80kD
• UniProt Protein Name: Nuclear cap-binding protein subunit 1
• UniProt Gene Name: NCBP1
• UniProt Synonym Gene Names: CBP80; NCBP; CBP80
• UniProt Entry Name: NCBP1_HUMAN

NCBI Description

The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. [provided by RefSeq, Jul 2008]

Uniprot Description

NCBP1: mediates U snRNA export from the nucleus. Binds to 5' capped mRNA. Found in aU snRNA export complex with RNUXA/PHAX, CBP20, CBP80, RAN, XPO1 and m7G-capped RNA. Interaction with RNUXA/PHAX. Heterodimer with NCBP2. Is part of the exon junction complex (EJC) containing NCBP1, NCBP2, RNPS1, RBM8A, SRRM1, NXF1, UPF3B, UPF2, THOC4 and/or REFBP2.

Protein type: Translation; Spliceosome; RNA processing

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: nucleoplasm; mRNA cap complex; mitochondrion; cytoplasm; nucleus; cytosol; ribonucleoprotein complex

Molecular Function: protein binding; RNA binding; RNA cap binding

Biological Process: transcription from RNA polymerase II promoter; spliceosomal snRNP biogenesis; viral reproduction; positive regulation of viral transcription; RNA splicing; histone mRNA metabolic process; positive regulation of mRNA 3'-end processing; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; mRNA capping; RNA elongation from RNA polymerase II promoter; mRNA catabolic process, nonsense-mediated decay; RNA-mediated gene silencing; gene expression; nuclear mRNA cis splicing, via U2-type spliceosome; mRNA 3'-end processing; termination of RNA polymerase II transcription; mRNA cleavage; regulation of translational initiation