Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human LMTK2 Monoclonal Antibody | anti-LMTK2 antibody

LMTK2 (Lemur Tyrosine Kinase 2, LMR2, Apoptosis-associated Tyrosine Kinase 2, AATYK2, Brain-enriched Kinase, BREK, hBREK, CDK5/p35-regulated Kinase, CPRK, FLJ46659, KIAA1079, Kinase/Phosphatase/Inhibitor 2, KPI2, KPI-2, Serine/threonine-protein Kinase LMT

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LMTK2; Monoclonal Antibody; LMTK2 (Lemur Tyrosine Kinase 2; LMR2; Apoptosis-associated Tyrosine Kinase 2; AATYK2; Brain-enriched Kinase; BREK; hBREK; CDK5/p35-regulated Kinase; CPRK; FLJ46659; KIAA1079; Kinase/Phosphatase/Inhibitor 2; KPI2; KPI-2; Serine/threonine-protein Kinase LMT; anti-LMTK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G1
Specificity
Recognizes human LMTK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1503
Applicable Applications for anti-LMTK2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.7ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1181-1280 from LMTK2 (NP_055731) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EPAQTGVPQQVHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPDIEGKYLGKLGVSGMLDLSED
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LMTK2 on formalin-fixed paraffin-embedded human ovary cancer. [antibody concentration 0.7ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LMTK2 on formalin-fixed paraffin-embedded human ovary cancer. [antibody concentration 0.7ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LMTK2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LMTK2 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-LMTK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase LMTK2
UniProt Protein Name
Serine/threonine-protein kinase LMTK2
UniProt Gene Name
LMTK2
UniProt Synonym Gene Names
AATYK2; BREK; KIAA1079; KPI2; LMR2; hBREK; CPRK
UniProt Entry Name
LMTK2_HUMAN

Uniprot Description

Lmr2: a tyrosine kinase of the Lmr family that apparently phosphorylates Serine and Threonine residues. Associates with PP1C and Inh2 to form a regulatory complex that localizes to membranes. Enriched in brain and muscle. Inhibited in living cells by addition of nerve growth factor or serum. Appears to be inhibited by Cdk5/p35.

Protein type: Membrane protein, multi-pass; Protein kinase, tyrosine (receptor); Protein kinase, TK; Membrane protein, integral; Kinase, protein; EC 2.7.11.1; TK group; Lmr family

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: Golgi apparatus; recycling endosome; perinuclear region of cytoplasm; early endosome; integral to membrane

Molecular Function: protein serine/threonine kinase activity; protein binding; protein phosphatase inhibitor activity; ATP binding

Biological Process: receptor recycling; peptidyl-serine phosphorylation; early endosome to late endosome transport; protein amino acid autophosphorylation; negative regulation of catalytic activity; peptidyl-threonine phosphorylation; transferrin transport; endocytic recycling; protein amino acid phosphorylation

Similar Products

Product Notes

The LMTK2 lmtk2 (Catalog #AAA6158638) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMTK2 (Lemur Tyrosine Kinase 2, LMR2, Apoptosis-associated Tyrosine Kinase 2, AATYK2, Brain-enriched Kinase, BREK, hBREK, CDK5/p35-regulated Kinase, CPRK, FLJ46659, KIAA1079, Kinase/Phosphatase/Inhibitor 2, KPI2, KPI-2, Serine/threonine-protein Kinase LMT reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMTK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.7ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMTK2 lmtk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMTK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.