<
Western Blot (WB)
(Western Blot detection against Immunogen (70.33kD).)
Mouse anti-Human WAPAL Monoclonal Antibody | anti-WAPAL antibody
WAPAL (Wings Apart-like Protein Homolog, WAPL, Friend of EBNA2 Protein, FOE, KIAA0261) (AP)
Gene Names
WAPL; FOE; WAPAL; KIAA0261
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WAPAL; Monoclonal Antibody; WAPAL (Wings Apart-like Protein Homolog; WAPL; Friend of EBNA2 Protein; FOE; KIAA0261) (AP); anti-WAPAL antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B3
Specificity
Recognizes human KIAA0261.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-WAPAL antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-403 from KIAA0261 (AAH17393) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDIRVLLFLER
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (70.33kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (70.33kD).)
Western Blot (WB)
(Western Blot analysis of KIAA0261 expression in transfected 293T cell line by KIAA0261 monoclonal antibody Lane 1: KIAA0261 transfected lysate (45.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of KIAA0261 expression in transfected 293T cell line by KIAA0261 monoclonal antibody Lane 1: KIAA0261 transfected lysate (45.6kD). Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of WAPAL transfected lysate using WAPAL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with WAPAL monoclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of WAPAL transfected lysate using WAPAL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with WAPAL monoclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged KIAA0261 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged KIAA0261 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-WAPAL antibody
Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.
Product Categories/Family for anti-WAPAL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
142,525 Da
NCBI Official Full Name
Homo sapiens wings apart-like homolog (Drosophila), mRNA
NCBI Official Synonym Full Names
WAPL cohesin release factor
NCBI Official Symbol
WAPL
NCBI Official Synonym Symbols
FOE; WAPAL; KIAA0261
NCBI Protein Information
wings apart-like protein homolog
Research Articles on WAPAL
Similar Products
Product Notes
The WAPAL (Catalog #AAA6131985) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WAPAL (Wings Apart-like Protein Homolog, WAPL, Friend of EBNA2 Protein, FOE, KIAA0261) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WAPAL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WAPAL for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WAPAL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
