Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HAVCR1 expression in transfected 293T cell line by HAVCR1 monoclonal antibody (M02), clone 2B9.Lane 1: HAVCR1 transfected lysate (38.72 KDa).Lane 2: Non-transfected lysate.)

Mouse HAVCR1 Monoclonal Antibody | anti-HAVCR1 antibody

HAVCR1 (Hepatitis A Virus Cellular Receptor 1, HAVCR, HAVCR-1, KIM-1, KIM1, TIM-1, TIM1, TIMD1) (Biotin)

Gene Names
HAVCR1; TIM; KIM1; TIM1; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1
Applications
Western Blot
Purity
Purified
Synonyms
HAVCR1; Monoclonal Antibody; HAVCR1 (Hepatitis A Virus Cellular Receptor 1; HAVCR; HAVCR-1; KIM-1; KIM1; TIM-1; TIM1; TIMD1) (Biotin); Hepatitis A Virus Cellular Receptor 1; TIMD1; anti-HAVCR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B9
Specificity
Recognizes HAVCR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HAVCR1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HAVCR1 (NP_036338, 23aa-122aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HAVCR1 expression in transfected 293T cell line by HAVCR1 monoclonal antibody (M02), clone 2B9.Lane 1: HAVCR1 transfected lysate (38.72 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HAVCR1 expression in transfected 293T cell line by HAVCR1 monoclonal antibody (M02), clone 2B9.Lane 1: HAVCR1 transfected lysate (38.72 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HAVCR1 is approximately 10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HAVCR1 is approximately 10ng/ml as a capture antibody.)
Related Product Information for anti-HAVCR1 antibody
Mouse monoclonal antibody raised against a partial recombinant HAVCR1.
Product Categories/Family for anti-HAVCR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,720 Da
NCBI Official Full Name
hepatitis A virus cellular receptor 1
NCBI Official Synonym Full Names
hepatitis A virus cellular receptor 1
NCBI Official Symbol
HAVCR1
NCBI Official Synonym Symbols
TIM; KIM1; TIM1; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1
NCBI Protein Information
hepatitis A virus cellular receptor 1; kidney injury molecule 1; T-cell membrane protein 1; T-cell immunoglobulin mucin receptor 1; T-cell immunoglobulin mucin family member 1; T cell immunoglobin domain and mucin domain protein 1
UniProt Protein Name
Hepatitis A virus cellular receptor 1
UniProt Gene Name
HAVCR1
UniProt Synonym Gene Names
KIM1; TIM1; TIMD1; HAVcr-1; KIM-1; TIMD-1; TIM; TIM-1
UniProt Entry Name
HAVR1_HUMAN

NCBI Description

The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

TIM-1: May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair. Belongs to the immunoglobulin superfamily. TIM family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q33.2

Cellular Component: integral to membrane

Molecular Function: viral receptor activity

Biological Process: entry of virus into host cell

Disease: Ige Responsiveness, Atopic

Research Articles on HAVCR1

Similar Products

Product Notes

The HAVCR1 havcr1 (Catalog #AAA6172641) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HAVCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAVCR1 havcr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAVCR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.