Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GSK3B Monoclonal Antibody | anti-GSK3B antibody

GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (HRP)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSK3B; Monoclonal Antibody; GSK3B (Glycogen Synthase Kinase-3 beta; GSK-3 beta; Serine/Threonine-protein Kinase GSK3B) (HRP); anti-GSK3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H3
Specificity
Recognizes human GSK3B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GSK3B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human GSK3B (NP_002084) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSK3B on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GSK3B on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GSK3B on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GSK3B on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSK3B is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GSK3B is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SMAD1 and GSK3B. HeLa cells were stained with SMAD1 rabbit purified polyclonal 1:1200 and GSK3B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SMAD1 and GSK3B. HeLa cells were stained with SMAD1 rabbit purified polyclonal 1:1200 and GSK3B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-GSK3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,034 Da
NCBI Official Full Name
glycogen synthase kinase-3 beta isoform 1
NCBI Official Synonym Full Names
glycogen synthase kinase 3 beta
NCBI Official Symbol
GSK3B
NCBI Protein Information
glycogen synthase kinase-3 beta
UniProt Protein Name
Glycogen synthase kinase-3 beta
Protein Family
UniProt Gene Name
GSK3B
UniProt Synonym Gene Names
GSK-3 beta
UniProt Entry Name
GSK3B_HUMAN

NCBI Description

The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017]

Uniprot Description

GSK3B: a proline-directed protein kinase of the GSK family. Phosphorylates and inactivates glycogen synthase. Participates in the Wnt signaling pathway. Involved in energy metabolism, neuronal cell development, and body pattern formation

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; EC 2.7.11.26; CMGC group; GSK family; GSK subfamily

Chromosomal Location of Human Ortholog: 3q13.3

Cellular Component: centrosome; dendritic spine; cytosol; beta-catenin destruction complex; ribonucleoprotein complex; lipid raft; nucleoplasm; growth cone; cell soma; perinuclear region of cytoplasm; cytoplasm; plasma membrane; dendritic shaft; nucleus

Molecular Function: p53 binding; beta-catenin binding; protein kinase binding; integrin binding; ionotropic glutamate receptor binding; protein serine/threonine kinase activity; NF-kappaB binding; protein binding; ubiquitin protein ligase binding; tau-protein kinase activity; kinase activity; tau protein binding; ATP binding

Biological Process: circadian rhythm; glycogen metabolic process; fat cell differentiation; axon guidance; negative regulation of MAP kinase activity; genetic imprinting; re-entry into mitotic cell cycle; nerve growth factor receptor signaling pathway; positive regulation of protein binding; protein amino acid autophosphorylation; response to lithium ion; positive regulation of axon extension; Wnt receptor signaling pathway through beta-catenin; protein amino acid phosphorylation; positive regulation of protein export from nucleus; protein export from nucleus; negative regulation of protein binding; positive regulation of cell-matrix adhesion; ER overload response; myoblast fusion; negative regulation of glycogen biosynthetic process; epidermal growth factor receptor signaling pathway; response to drug; regulation of microtubule-based process; cell migration; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; hippocampus development; negative regulation of dendrite morphogenesis; negative regulation of NFAT protein import into nucleus; positive regulation of peptidyl-serine phosphorylation; organ morphogenesis; negative regulation of neuron maturation; peptidyl-serine phosphorylation; positive regulation of protein complex assembly; establishment of cell polarity; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein catabolic process; epithelial to mesenchymal transition; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein complex assembly; regulation of neuronal synaptic plasticity; negative regulation of apoptosis

Research Articles on GSK3B

Similar Products

Product Notes

The GSK3B gsk3b (Catalog #AAA6152786) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSK3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSK3B gsk3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSK3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.