Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GSK3B rabbit polyclonal antibody. Western Blot analysis of GSK3B expression in mouse stomach.)

Rabbit anti-Human, Mouse GSK3B Polyclonal Antibody | anti-GSK3B antibody

GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (PE)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSK3B; Polyclonal Antibody; GSK3B (Glycogen Synthase Kinase-3 beta; GSK-3 beta; Serine/Threonine-protein Kinase GSK3B) (PE); anti-GSK3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GSK3B. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GSK3B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GSK3B, aa1-433 (NP_002084.2).
Immunogen Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSK3B rabbit polyclonal antibody. Western Blot analysis of GSK3B expression in mouse stomach.)

Western Blot (WB) (GSK3B rabbit polyclonal antibody. Western Blot analysis of GSK3B expression in mouse stomach.)

Western Blot (WB)

(Western Blot analysis of GSK3B expression in transfected 293T cell line by GSK3B polyclonal antibody. Lane 1: GSK3B transfected lysate (48kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSK3B expression in transfected 293T cell line by GSK3B polyclonal antibody. Lane 1: GSK3B transfected lysate (48kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GSK3B antibody
Glycogen synthase kinase 3 (GSK-3) is a serine/threonine protein kinase that has been implicated in the regulation of cell fate and in the Wnt signaling pathway. GSK-3 plays an important role in the PI3 kinase and Akt mediated cell survival pathways, and its activity can be inhibited by Akt-mediated phosphorylation at Ser21 of GSK-3a and Ser9 of GSK-3b. GSK-3 has also been implicated in alzheimer's disease. Six Tau protein isoforms have been identified, all of which are phosphorylated by GSK-3.
Product Categories/Family for anti-GSK3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,034 Da
NCBI Official Full Name
glycogen synthase kinase-3 beta isoform 1
NCBI Official Synonym Full Names
glycogen synthase kinase 3 beta
NCBI Official Symbol
GSK3B
NCBI Protein Information
glycogen synthase kinase-3 beta
UniProt Protein Name
Glycogen synthase kinase-3 beta
Protein Family
UniProt Gene Name
GSK3B
UniProt Synonym Gene Names
GSK-3 beta
UniProt Entry Name
GSK3B_HUMAN

NCBI Description

The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017]

Uniprot Description

GSK3B: a proline-directed protein kinase of the GSK family. Phosphorylates and inactivates glycogen synthase. Participates in the Wnt signaling pathway. Involved in energy metabolism, neuronal cell development, and body pattern formation

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; EC 2.7.11.26; CMGC group; GSK family; GSK subfamily

Chromosomal Location of Human Ortholog: 3q13.3

Cellular Component: centrosome; dendritic spine; cytosol; beta-catenin destruction complex; ribonucleoprotein complex; lipid raft; nucleoplasm; growth cone; cell soma; perinuclear region of cytoplasm; cytoplasm; plasma membrane; dendritic shaft; nucleus

Molecular Function: p53 binding; beta-catenin binding; protein kinase binding; integrin binding; ionotropic glutamate receptor binding; protein serine/threonine kinase activity; NF-kappaB binding; protein binding; ubiquitin protein ligase binding; tau-protein kinase activity; kinase activity; tau protein binding; ATP binding

Biological Process: circadian rhythm; glycogen metabolic process; fat cell differentiation; axon guidance; negative regulation of MAP kinase activity; genetic imprinting; re-entry into mitotic cell cycle; nerve growth factor receptor signaling pathway; positive regulation of protein binding; protein amino acid autophosphorylation; response to lithium ion; positive regulation of axon extension; Wnt receptor signaling pathway through beta-catenin; protein amino acid phosphorylation; positive regulation of protein export from nucleus; protein export from nucleus; negative regulation of protein binding; positive regulation of cell-matrix adhesion; ER overload response; myoblast fusion; negative regulation of glycogen biosynthetic process; epidermal growth factor receptor signaling pathway; response to drug; regulation of microtubule-based process; cell migration; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; hippocampus development; negative regulation of dendrite morphogenesis; negative regulation of NFAT protein import into nucleus; positive regulation of peptidyl-serine phosphorylation; organ morphogenesis; negative regulation of neuron maturation; peptidyl-serine phosphorylation; positive regulation of protein complex assembly; establishment of cell polarity; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein catabolic process; epithelial to mesenchymal transition; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein complex assembly; regulation of neuronal synaptic plasticity; negative regulation of apoptosis

Research Articles on GSK3B

Similar Products

Product Notes

The GSK3B gsk3b (Catalog #AAA6380340) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GSK3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSK3B gsk3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSK3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.