Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ESRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human, Mouse ESRP1 Polyclonal Antibody | anti-ESRP1 antibody
ESRP1 Polyclonal Antibody
Gene Names
ESRP1; RBM35A; RMB35A
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ESRP1; Polyclonal Antibody; ESRP1 Polyclonal Antibody; RBM35A; RMB35A; anti-ESRP1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMEL
Sequence Length
677
Applicable Applications for anti-ESRP1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ESRP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
LO2, MCF7, HT-29, 293T, Mouse thymus, Mouse pancreas
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ESRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ESRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Product Categories/Family for anti-ESRP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 67kDa; 73kDa; 75kDa
Observed: 75kDa
Observed: 75kDa
NCBI Official Full Name
epithelial splicing regulatory protein 1 isoform 2
NCBI Official Synonym Full Names
epithelial splicing regulatory protein 1
NCBI Official Symbol
ESRP1
NCBI Official Synonym Symbols
RBM35A; RMB35A
NCBI Protein Information
epithelial splicing regulatory protein 1
UniProt Protein Name
Epithelial splicing regulatory protein 1
Protein Family
UniProt Gene Name
ESRP1
UniProt Synonym Gene Names
RBM35A
NCBI Description
ESPR1 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 [PubMed 19285943]).[supplied by OMIM, Aug 2009]
Uniprot Description
mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). Acts by directly binding specific sequences in mRNAs. Binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2.
Research Articles on ESRP1
Similar Products
Product Notes
The ESRP1 esrp1 (Catalog #AAA9134625) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRP1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ESRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ESRP1 esrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTASPDYLVV LFGITAGATG AKLGSDEKEL ILLFWKVVDL ANKKVGQLHE VLVRPDQLEL TEDCKEETKI DVESLSSASQ LDQALRQFNQ SVSNELNIGV GTSFCLCTDG QLHVRQILHP EASKKNVLLP ECFYSFFDLR KEFKKCCPGS PDIDKLDVAT MTEYLNFEKS SSVSRYGASQ VEDMGNIILA MISEPYNHRF SDPERVNYKF ESGTCSKMEL. It is sometimes possible for the material contained within the vial of "ESRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
