Rabbit anti-Human, Mouse GSK3B Polyclonal Antibody | anti-GSK3B antibody

GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (AP)

Cat. Num. AAA6380330

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSK3B; Polyclonal Antibody; GSK3B (Glycogen Synthase Kinase-3 beta; GSK-3 beta; Serine/Threonine-protein Kinase GSK3B) (AP); anti-GSK3B antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSK3B. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GSK3B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSK3B, aa1-433 (NP_002084.2).
• Immunogen Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSK3B rabbit polyclonal antibody. Western Blot analysis of GSK3B expression in mouse stomach.)

Western Blot (WB)

(Western Blot analysis of GSK3B expression in transfected 293T cell line by GSK3B polyclonal antibody. Lane 1: GSK3B transfected lysate (48kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-GSK3B antibody

Glycogen synthase kinase 3 (GSK-3) is a serine/threonine protein kinase that has been implicated in the regulation of cell fate and in the Wnt signaling pathway. GSK-3 plays an important role in the PI3 kinase and Akt mediated cell survival pathways, and its activity can be inhibited by Akt-mediated phosphorylation at Ser21 of GSK-3a and Ser9 of GSK-3b. GSK-3 has also been implicated in alzheimer's disease. Six Tau protein isoforms have been identified, all of which are phosphorylated by GSK-3.

Product Categories/Family for anti-GSK3B antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 21361340
• NCBI GeneID: 2932
• NCBI Accession #: NP_002084.2
• NCBI GenBank Nucleotide #: NM_002093
• UniProt Accession #: P49841; Q9BWH3; Q9UL47; D3DN89
• Molecular Weight: 48,034 Da
• NCBI Official Full Name: glycogen synthase kinase-3 beta isoform 1
• NCBI Official Synonym Full Names: glycogen synthase kinase 3 beta
• NCBI Official Symbol: GSK3B
• NCBI Protein Information: glycogen synthase kinase-3 beta
• UniProt Protein Name: Glycogen synthase kinase-3 beta
• Protein Family: Glycogen synthase kinase
• UniProt Gene Name: GSK3B
• UniProt Synonym Gene Names: GSK-3 beta
• UniProt Entry Name: GSK3B_HUMAN

NCBI Description

The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017]

Uniprot Description

GSK3B: a proline-directed protein kinase of the GSK family. Phosphorylates and inactivates glycogen synthase. Participates in the Wnt signaling pathway. Involved in energy metabolism, neuronal cell development, and body pattern formation

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; EC 2.7.11.26; CMGC group; GSK family; GSK subfamily

Chromosomal Location of Human Ortholog: 3q13.3

Cellular Component: centrosome; dendritic spine; cytosol; beta-catenin destruction complex; ribonucleoprotein complex; lipid raft; nucleoplasm; growth cone; cell soma; perinuclear region of cytoplasm; cytoplasm; plasma membrane; dendritic shaft; nucleus

Molecular Function: p53 binding; beta-catenin binding; protein kinase binding; integrin binding; ionotropic glutamate receptor binding; protein serine/threonine kinase activity; NF-kappaB binding; protein binding; ubiquitin protein ligase binding; tau-protein kinase activity; kinase activity; tau protein binding; ATP binding

Biological Process: circadian rhythm; glycogen metabolic process; fat cell differentiation; axon guidance; negative regulation of MAP kinase activity; genetic imprinting; re-entry into mitotic cell cycle; nerve growth factor receptor signaling pathway; positive regulation of protein binding; protein amino acid autophosphorylation; response to lithium ion; positive regulation of axon extension; Wnt receptor signaling pathway through beta-catenin; protein amino acid phosphorylation; positive regulation of protein export from nucleus; protein export from nucleus; negative regulation of protein binding; positive regulation of cell-matrix adhesion; ER overload response; myoblast fusion; negative regulation of glycogen biosynthetic process; epidermal growth factor receptor signaling pathway; response to drug; regulation of microtubule-based process; cell migration; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; hippocampus development; negative regulation of dendrite morphogenesis; negative regulation of NFAT protein import into nucleus; positive regulation of peptidyl-serine phosphorylation; organ morphogenesis; negative regulation of neuron maturation; peptidyl-serine phosphorylation; positive regulation of protein complex assembly; establishment of cell polarity; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein catabolic process; epithelial to mesenchymal transition; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein complex assembly; regulation of neuronal synaptic plasticity; negative regulation of apoptosis