Mouse anti-Human GSK3B Monoclonal Antibody | anti-GSK3B antibody

GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (AP)

Cat. Num. AAA6131574

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSK3B; Monoclonal Antibody; GSK3B (Glycogen Synthase Kinase-3 beta; GSK-3 beta; Serine/Threonine-protein Kinase GSK3B) (AP); anti-GSK3B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H3
• Specificity: Recognizes human GSK3B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GSK3B antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human GSK3B (NP_002084) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSK3B on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GSK3B on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSK3B is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SMAD1 and GSK3B. HeLa cells were stained with SMAD1 rabbit purified polyclonal 1:1200 and GSK3B mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-GSK3B antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 21361340
• NCBI GeneID: 2932
• NCBI Accession #: NP_002084
• NCBI GenBank Nucleotide #: NM_002093
• UniProt Accession #: P49841; Q9BWH3; Q9UL47; D3DN89
• Molecular Weight: 48,034 Da
• NCBI Official Full Name: glycogen synthase kinase-3 beta isoform 1
• NCBI Official Synonym Full Names: glycogen synthase kinase 3 beta
• NCBI Official Symbol: GSK3B
• NCBI Protein Information: glycogen synthase kinase-3 beta
• UniProt Protein Name: Glycogen synthase kinase-3 beta
• Protein Family: Glycogen synthase kinase
• UniProt Gene Name: GSK3B
• UniProt Synonym Gene Names: GSK-3 beta
• UniProt Entry Name: GSK3B_HUMAN

NCBI Description

The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017]

Uniprot Description

GSK3B: a proline-directed protein kinase of the GSK family. Phosphorylates and inactivates glycogen synthase. Participates in the Wnt signaling pathway. Involved in energy metabolism, neuronal cell development, and body pattern formation

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; EC 2.7.11.26; CMGC group; GSK family; GSK subfamily

Chromosomal Location of Human Ortholog: 3q13.3

Cellular Component: centrosome; dendritic spine; cytosol; beta-catenin destruction complex; ribonucleoprotein complex; lipid raft; nucleoplasm; growth cone; cell soma; perinuclear region of cytoplasm; cytoplasm; plasma membrane; dendritic shaft; nucleus

Molecular Function: p53 binding; beta-catenin binding; protein kinase binding; integrin binding; ionotropic glutamate receptor binding; protein serine/threonine kinase activity; NF-kappaB binding; protein binding; ubiquitin protein ligase binding; tau-protein kinase activity; kinase activity; tau protein binding; ATP binding

Biological Process: circadian rhythm; glycogen metabolic process; fat cell differentiation; axon guidance; negative regulation of MAP kinase activity; genetic imprinting; re-entry into mitotic cell cycle; nerve growth factor receptor signaling pathway; positive regulation of protein binding; protein amino acid autophosphorylation; response to lithium ion; positive regulation of axon extension; Wnt receptor signaling pathway through beta-catenin; protein amino acid phosphorylation; positive regulation of protein export from nucleus; protein export from nucleus; negative regulation of protein binding; positive regulation of cell-matrix adhesion; ER overload response; myoblast fusion; negative regulation of glycogen biosynthetic process; epidermal growth factor receptor signaling pathway; response to drug; regulation of microtubule-based process; cell migration; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; hippocampus development; negative regulation of dendrite morphogenesis; negative regulation of NFAT protein import into nucleus; positive regulation of peptidyl-serine phosphorylation; organ morphogenesis; negative regulation of neuron maturation; peptidyl-serine phosphorylation; positive regulation of protein complex assembly; establishment of cell polarity; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein catabolic process; epithelial to mesenchymal transition; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein complex assembly; regulation of neuronal synaptic plasticity; negative regulation of apoptosis