Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GPR154 is ~0.03ng/ml using MBS6000802 as a capture antibody.)

Mouse anti-Human GPR154 Monoclonal Antibody | anti-GPR154 antibody

GPR154 (Neuropeptide S Receptor, G-protein Coupled Receptor 154, G-protein Coupled Receptor PGR14, G-protein Coupled Receptor for Asthma Susceptibility, NPSR1, GPRA, PGR14) (MaxLight 750)

Gene Names
NPSR1; GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GPR154; Monoclonal Antibody; GPR154 (Neuropeptide S Receptor; G-protein Coupled Receptor 154; G-protein Coupled Receptor PGR14; G-protein Coupled Receptor for Asthma Susceptibility; NPSR1; GPRA; PGR14) (MaxLight 750); anti-GPR154 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F5
Specificity
Recognizes human GPR154.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-GPR154 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa2-53 of human GPR154 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GPR154 is ~0.03ng/ml using MBS6000802 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GPR154 is ~0.03ng/ml using MBS6000802 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using MBS6000802 (31.83kD).)

Western Blot (WB) (Western Blot detection against Immunogen using MBS6000802 (31.83kD).)
Related Product Information for anti-GPR154 antibody
May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases.
Product Categories/Family for anti-GPR154 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,612 Da
NCBI Official Full Name
neuropeptide S receptor isoform B
NCBI Official Synonym Full Names
neuropeptide S receptor 1
NCBI Official Symbol
NPSR1
NCBI Official Synonym Symbols
GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154
NCBI Protein Information
neuropeptide S receptor
UniProt Protein Name
Neuropeptide S receptor
UniProt Gene Name
NPSR1
UniProt Synonym Gene Names
GPR154; GPRA; PGR14
UniProt Entry Name
NPSR1_HUMAN

NCBI Description

This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

NPSR1: May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases. Defects in NPSR1 are a cause of asthma-related traits type 2 (ASRT2). Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy and atopic dermatitis. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7p14.3

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: neuropeptide receptor activity; vasopressin receptor activity

Biological Process: neuropeptide signaling pathway; positive regulation of release of sequestered calcium ion into cytosol

Disease: Asthma-related Traits, Susceptibility To, 2

Research Articles on GPR154

Similar Products

Product Notes

The GPR154 npsr1 (Catalog #AAA6233099) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GPR154 (Neuropeptide S Receptor, G-protein Coupled Receptor 154, G-protein Coupled Receptor PGR14, G-protein Coupled Receptor for Asthma Susceptibility, NPSR1, GPRA, PGR14) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR154 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPR154 npsr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR154, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.