Mouse anti-Human GPR154 Monoclonal Antibody | anti-GPR154 antibody

GPR154 (Neuropeptide S Receptor, G-protein Coupled Receptor 154, G-protein Coupled Receptor PGR14, G-protein Coupled Receptor for Asthma Susceptibility, NPSR1, GPRA, PGR14) (FITC)

Cat. Num. AAA6147445

• Gene Names: NPSR1; GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GPR154; Monoclonal Antibody; GPR154 (Neuropeptide S Receptor; G-protein Coupled Receptor 154; G-protein Coupled Receptor PGR14; G-protein Coupled Receptor for Asthma Susceptibility; NPSR1; GPRA; PGR14) (FITC); anti-GPR154 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F5
• Specificity: Recognizes human GPR154.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GPR154 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa2-53 of human GPR154 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GPR154 is ~0.03ng/ml using MBS6000802 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using MBS6000802 (31.83kD).)

Related Product Information for anti-GPR154 antibody

May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases.

Product Categories/Family for anti-GPR154 antibody

Antibodies; G Protein Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 46391085
• NCBI GeneID: 387129
• NCBI Accession #: NP_997056
• NCBI GenBank Nucleotide #: NM_207173
• UniProt Accession #: Q6W5P4; Q2XP58; Q56H76; Q56H77; Q56H78; Q6JSL4; Q6JSL5; Q6JSL6; Q6JSL7; Q6JSL8; Q6W5P3; A2RTZ4
• Molecular Weight: 10,612 Da
• NCBI Official Full Name: neuropeptide S receptor isoform B
• NCBI Official Synonym Full Names: neuropeptide S receptor 1
• NCBI Official Symbol: NPSR1
• NCBI Official Synonym Symbols: GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154
• NCBI Protein Information: neuropeptide S receptor
• UniProt Protein Name: Neuropeptide S receptor
• UniProt Gene Name: NPSR1
• UniProt Synonym Gene Names: GPR154; GPRA; PGR14
• UniProt Entry Name: NPSR1_HUMAN

NCBI Description

This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

NPSR1: May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases. Defects in NPSR1 are a cause of asthma-related traits type 2 (ASRT2). Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy and atopic dermatitis. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7p14.3

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: neuropeptide receptor activity; vasopressin receptor activity

Biological Process: neuropeptide signaling pathway; positive regulation of release of sequestered calcium ion into cytosol

Disease: Asthma-related Traits, Susceptibility To, 2