Mouse anti-Human G-Protein Coupled Receptor 127 Monoclonal Antibody | anti-GPR127 antibody

G-Protein Coupled Receptor 127 (Putative EGF-like module-containing mucin-like hormone receptor-like 4, G-protein coupled receptor PGF16, EMR4, GPR127, PGR16) (PE)

Cat. Num. AAA6157907

• Gene Names: ADGRE4P; EMR4; FIRE; EMR4P; PGR16; GPR127
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: G-Protein Coupled Receptor 127; Monoclonal Antibody; G-Protein Coupled Receptor 127 (Putative EGF-like module-containing mucin-like hormone receptor-like 4; G-protein coupled receptor PGF16; EMR4; GPR127; PGR16) (PE); anti-GPR127 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H8
• Specificity: Recognizes human EMR4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-GPR127 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa21-94 from human EMR4 (XP_377506) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EMR4P on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged EMR4 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-GPR127 antibody

Antibodies; G Protein Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 113428060
• NCBI GeneID: 326342
• UniProt Accession #: NM_001080498
• NCBI Official Synonym Full Names: adhesion G protein-coupled receptor E4, pseudogene
• NCBI Official Symbol: ADGRE4P
• NCBI Official Synonym Symbols: EMR4; FIRE; EMR4P; PGR16; GPR127

NCBI Description

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq, Aug 2008]