Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CARD9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit CARD9 Polyclonal Antibody | anti-CARD9 antibody

CARD9 antibody - middle region

Gene Names
CARD9; CANDF2; hCARD9
Reactivity
Dog, Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CARD9; Polyclonal Antibody; CARD9 antibody - middle region; anti-CARD9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR
Sequence Length
536
Applicable Applications for anti-CARD9 antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 86%; Human: 100%; Mouse: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CARD9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CARD9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-CARD9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-CARD9 antibody
This is a rabbit polyclonal antibody against CARD9. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined.
Product Categories/Family for anti-CARD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
caspase recruitment domain-containing protein 9 isoform 1
NCBI Official Synonym Full Names
caspase recruitment domain family member 9
NCBI Official Symbol
CARD9
NCBI Official Synonym Symbols
CANDF2; hCARD9
NCBI Protein Information
caspase recruitment domain-containing protein 9
UniProt Protein Name
Caspase recruitment domain-containing protein 9
UniProt Gene Name
CARD9
UniProt Synonym Gene Names
hCARD9
UniProt Entry Name
CARD9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. [provided by RefSeq, Jul 2008]

Uniprot Description

CARD9: Activates NF-kappa-B via BCL10. Defects in CARD9 are the cause of familial candidiasis type 2 (CANDF2). Chronic mucocutaneous candidiasis is characterized by impaired clearance of fungal infections and results in colonization and infections of the mucosa or skin, predominantly with Candida albicans. CANDF2 is an autosomal recessive chronic mucocutaneous candidiasis. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: cytoplasm

Molecular Function: protein homodimerization activity; CARD domain binding

Biological Process: response to drug; response to fungus; positive regulation of I-kappaB kinase/NF-kappaB cascade; regulation of interleukin-2 biosynthetic process; regulation of interleukin-6 biosynthetic process; positive regulation of interleukin-6 production; positive regulation of JNK cascade; positive regulation of tumor necrosis factor production; positive regulation of stress-activated MAPK cascade; regulation of apoptosis; defense response to Gram-positive bacterium; response to exogenous dsRNA; response to muramyl dipeptide; response to peptidoglycan; innate immune response; defense response to virus; regulation of tumor necrosis factor biosynthetic process

Disease: Candidiasis, Familial, 2

Research Articles on CARD9

Similar Products

Product Notes

The CARD9 card9 (Catalog #AAA3213511) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARD9 antibody - middle region reacts with Dog, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CARD9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CARD9 card9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALHQEQVLRN PHDAGLSSGE PPEKERRRLK ESFENYRRKR ALRKMQKGWR. It is sometimes possible for the material contained within the vial of "CARD9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.