Western Blot (WB)
(EMR4P monoclonal antibody (M02), clone 1G10. Western Blot analysis of EMR4P expression in HeLa.)
Mouse EMR4P Monoclonal Antibody | anti-EMR4P antibody
EMR4P (egf-like module Containing, Mucin-like, Hormone Receptor-like 4 Pseudogene, EMR4, FIRE, GPR127, PGR16) (AP)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
EMR4P; Monoclonal Antibody; EMR4P (egf-like module Containing; Mucin-like; Hormone Receptor-like 4 Pseudogene; EMR4; FIRE; GPR127; PGR16) (AP); egf-like module Containing; PGR16; anti-EMR4P antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes EMR4P.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EMR4P antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EMR4P (XP_377506, 21aa-93aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(EMR4P monoclonal antibody (M02), clone 1G10. Western Blot analysis of EMR4P expression in HeLa.)
Western Blot (WB)
(EMR4P monoclonal antibody (M02), clone 1G10. Western Blot analysis of EMR4P expression in HeLa.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EMR4P on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EMR4P on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EMR4P on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EMR4P on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-EMR4P antibody
This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq]
Product Categories/Family for anti-EMR4P antibody
NCBI and Uniprot Product Information
NCBI GI #
Similar Products
Product Notes
The EMR4P (Catalog #AAA6165047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EMR4P can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EMR4P for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EMR4P, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
