Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FBXO27 is 3ng/ml as a capture antibody.)

Mouse anti-Human FBXO27 Monoclonal Antibody | anti-FBXO27 antibody

FBXO27 (F-box Only Protein 27, F-box/G-domain Protein 5, FBG5, FBX27)

Gene Names
FBXO27; FBG5; Fbx27
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FBXO27; Monoclonal Antibody; FBXO27 (F-box Only Protein 27; F-box/G-domain Protein 5; FBG5; FBX27); Anti -FBXO27 (F-box Only Protein 27; anti-FBXO27 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human FBXO27.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
WGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
Applicable Applications for anti-FBXO27 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa192-284 from human FBXO27 (NP_849142) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FBXO27 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FBXO27 is 3ng/ml as a capture antibody.)
Related Product Information for anti-FBXO27 antibody
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Able to recognize and bind denatured glycoproteins, which are modified with complex-type oligosaccharides.
Product Categories/Family for anti-FBXO27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31,623 Da
NCBI Official Full Name
FBXO27 protein
NCBI Official Synonym Full Names
F-box protein 27
NCBI Official Symbol
FBXO27
NCBI Official Synonym Symbols
FBG5; Fbx27
NCBI Protein Information
F-box only protein 27; F-box protein FBG5; F-box/G-domain protein 5
UniProt Protein Name
F-box only protein 27
Protein Family
UniProt Gene Name
FBXO27
UniProt Synonym Gene Names
FBG5; FBX27
UniProt Entry Name
FBX27_HUMAN

NCBI Description

Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Uniprot Description

FBXO27: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. Able to recognize and bind denatured glycoproteins, which are modified with complex- type oligosaccharides.

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: SCF ubiquitin ligase complex

Molecular Function: protein binding; glycoprotein binding

Similar Products

Product Notes

The FBXO27 fbxo27 (Catalog #AAA643631) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXO27 (F-box Only Protein 27, F-box/G-domain Protein 5, FBG5, FBX27) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO27 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the FBXO27 fbxo27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WGARHDSGCM YRLLVQLLDA NQTVLDKFSA VPDPIPQWNN NACLHVTHVF SNIKMGVRFV SFEHRGQDTQ FWAGHYGARV TNSSVIVRVR LS. It is sometimes possible for the material contained within the vial of "FBXO27, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.