Mouse anti-Human FBXW12 Monoclonal Antibody | anti-FBXW12 antibody

FBXW12 (FBW12, FBXO12, FBXO35, F-box/WD Repeat-containing Protein 12, F-box and WD-40 Domain-containing Protein 12, F-box Only Protein 35, MGC120385, MGC120386, MGC120387)

Cat. Num. AAA6012828

• Gene Names: FBXW12; FBW12; FBXO12; FBXO35
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: FBXW12; Monoclonal Antibody; FBXW12 (FBW12; FBXO12; FBXO35; F-box/WD Repeat-containing Protein 12; F-box and WD-40 Domain-containing Protein 12; F-box Only Protein 35; MGC120385; MGC120386; MGC120387); Anti -FBXW12 (FBW12; anti-FBXW12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A9
• Specificity: Recognizes human FBXW12.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM*

• Applicable Applications for anti-FBXW12 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
• Immunogen: Partial recombinant protein corresponding to aa265-355 from human FBXW12 (NP_996985) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Testing Data

(Detection limit for recombinant GST tagged FBXW12 is 3ng/ml as a capture antibody.)

Related Product Information for anti-FBXW12 antibody

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Product Categories/Family for anti-FBXW12 antibody

Antibodies; Abs to Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 229576906
• NCBI GeneID: 285231
• NCBI Accession #: NP_001153401.1
• NCBI GenBank Nucleotide #: NM_001159929.1
• UniProt Accession #: Q6X9E4; Q494Y9; Q494Z0; E9PG36
• Molecular Weight: 53,056 Da
• NCBI Official Full Name: F-box/WD repeat-containing protein 12 isoform 3
• NCBI Official Synonym Full Names: F-box and WD repeat domain containing 12
• NCBI Official Symbol: FBXW12
• NCBI Official Synonym Symbols: FBW12; FBXO12; FBXO35
• NCBI Protein Information: F-box/WD repeat-containing protein 12; F-box only protein 35; F-box and WD-40 domain protein 12; F-box- and WD40-repeat-containing protein; F-box and WD-40 domain-containing protein 12
• UniProt Protein Name: F-box/WD repeat-containing protein 12
• Protein Family: F-box/WD repeat-containing protein
• UniProt Gene Name: FBXW12
• UniProt Synonym Gene Names: FBW12; FBXO12; FBXO35
• UniProt Entry Name: FBW12_HUMAN

NCBI Description

Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]

Uniprot Description

FBXW12: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 3p21.31