Mouse anti-Human ELK1 Monoclonal Antibody | anti-ELK1 antibody

ELK1 (ETS Domain-containing Protein Elk-1) (PE)

Cat. Num. AAA6157623

• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ELK1; Monoclonal Antibody; ELK1 (ETS Domain-containing Protein Elk-1) (PE); anti-ELK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G6
• Specificity: Recognizes human ELK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ELK1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa67-166 from human ELK1 (NP_005220) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ELK1 is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and ELK1 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and ELK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-ELK1 antibody

Elk-1 is a transcription factor that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. Elk-1 is phosphorylated by MAP kinase pathways and appears to be a direct target of activated MAP kinase. Biochemical studies indicate that Elk-1 is a good substrate for MAP kinase. The kinetics of Elk-1 phosphorylation and activation correlate with MAP kinase activity. Other studies have shown that Elk-1 (Ser383) is also a target of the stress-activated kinase SAPK/JNK.

Product Categories/Family for anti-ELK1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 166362730
• NCBI GeneID: 2002
• NCBI Accession #: NP_005220
• NCBI GenBank Nucleotide #: NM_005229
• UniProt Accession #: P19419
• Molecular Weight: 45kDa
• NCBI Official Full Name: ETS domain-containing protein Elk-1 isoform a
• NCBI Official Synonym Full Names: ETS transcription factor ELK1
• NCBI Official Symbol: ELK1
• NCBI Protein Information: ETS domain-containing protein Elk-1
• UniProt Protein Name: ETS domain-containing protein Elk-1
• Protein Family: ETS domain-containing protein
• UniProt Gene Name: ELK1
• UniProt Entry Name: ELK1_HUMAN

NCBI Description

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012]

Uniprot Description

ELK1: a transcription factor of the Ets family and the ternary complex factor (TCF) subfamily. Forms a ternary complex by binding to the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. Mediates gene activity in response to serum and growth factors. Phosphorylated by MAP kinase pathways at a cluster of S/T motifs at its C-terminus; phosphorylation at these sites is critical for transcriptional activation by Elk-1. Two alternatively-spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: Xp11.2

Cellular Component: nucleoplasm; mitochondrion; cell soma; dendrite; nerve terminal; nucleus

Molecular Function: protein binding; double-stranded DNA binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; response to light stimulus; nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; positive regulation of transcription, DNA-dependent; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; cell differentiation; toll-like receptor 4 signaling pathway