Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ELK1 is ~1ng/ml as a capture antibody.)

Mouse anti-Human ELK1 Monoclonal Antibody | anti-ELK1 antibody

ELK1 (ETS Domain-containing Protein Elk-1) (Biotin)

Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELK1; Monoclonal Antibody; ELK1 (ETS Domain-containing Protein Elk-1) (Biotin); anti-ELK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G6
Specificity
Recognizes human ELK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ELK1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa67-166 from human ELK1 (NP_005220) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ELK1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELK1 is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and ELK1 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and ELK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and ELK1 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and ELK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-ELK1 antibody
Elk-1 is a transcription factor that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. Elk-1 is phosphorylated by MAP kinase pathways and appears to be a direct target of activated MAP kinase. Biochemical studies indicate that Elk-1 is a good substrate for MAP kinase. The kinetics of Elk-1 phosphorylation and activation correlate with MAP kinase activity. Other studies have shown that Elk-1 (Ser383) is also a target of the stress-activated kinase SAPK/JNK.
Product Categories/Family for anti-ELK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
ETS domain-containing protein Elk-1 isoform a
NCBI Official Synonym Full Names
ETS transcription factor ELK1
NCBI Official Symbol
ELK1
NCBI Protein Information
ETS domain-containing protein Elk-1
UniProt Protein Name
ETS domain-containing protein Elk-1
UniProt Gene Name
ELK1
UniProt Entry Name
ELK1_HUMAN

NCBI Description

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012]

Uniprot Description

ELK1: a transcription factor of the Ets family and the ternary complex factor (TCF) subfamily. Forms a ternary complex by binding to the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. Mediates gene activity in response to serum and growth factors. Phosphorylated by MAP kinase pathways at a cluster of S/T motifs at its C-terminus; phosphorylation at these sites is critical for transcriptional activation by Elk-1. Two alternatively-spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: Xp11.2

Cellular Component: nucleoplasm; mitochondrion; cell soma; dendrite; nerve terminal; nucleus

Molecular Function: protein binding; double-stranded DNA binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; response to light stimulus; nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; positive regulation of transcription, DNA-dependent; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; cell differentiation; toll-like receptor 4 signaling pathway

Research Articles on ELK1

Similar Products

Product Notes

The ELK1 elk1 (Catalog #AAA6141714) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELK1 (ETS Domain-containing Protein Elk-1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELK1 elk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.