Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EIF3S3 monoclonal antibody Western Blot analysis of EIF3S3 expression in Jurkat.)

Mouse anti-Human EIF3H Monoclonal Antibody | anti-LOC100190645 antibody

EIF3H (Eukaryotic Translation Initiation Factor 3 Subunit H, eIF3h, Eukaryotic Translation Initiation Factor 3 Subunit 3, eIF-3 gamma, eIF3 p40 Subunit, EIF3S3, MGC102958)

Gene Names
LOC100190645; EIF3H; EIF3S3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
EIF3H; Monoclonal Antibody; EIF3H (Eukaryotic Translation Initiation Factor 3 Subunit H; eIF3h; Eukaryotic Translation Initiation Factor 3 Subunit 3; eIF-3 gamma; eIF3 p40 Subunit; EIF3S3; MGC102958); Anti -EIF3H (Eukaryotic Translation Initiation Factor 3 Subunit H; anti-LOC100190645 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B12
Specificity
Recognizes human EIF3S3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
YDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRV*
Applicable Applications for anti-LOC100190645 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa152-251 from EIF3S3 (NP_003747) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(EIF3S3 monoclonal antibody Western Blot analysis of EIF3S3 expression in Jurkat.)

Western Blot (WB) (EIF3S3 monoclonal antibody Western Blot analysis of EIF3S3 expression in Jurkat.)

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged EIF3S3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EIF3S3 is 1ng/ml as a capture antibody.)
Related Product Information for anti-LOC100190645 antibody
EIF3H is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
Product Categories/Family for anti-LOC100190645 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,529 Da
NCBI Official Full Name
Eukaryotic translation initiation factor 3 subunit H
NCBI Official Symbol
LOC100190645
NCBI Official Synonym Symbols
EIF3H; EIF3S3
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit H; eIF-3 gamma; eIF-3-gamma; eIF3 p40 subunit; putative eukaryotic translation initiation factor 3 subunit 3 gamma
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit H
UniProt Gene Name
EIF3H
UniProt Synonym Gene Names
EIF3S3; eIF3h
UniProt Entry Name
EIF3H_TAEGU

Uniprot Description

Function: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome

By similarity. HAMAP-Rule MF_03007

Subunit structure: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M

By similarity.

Subcellular location: Cytoplasm

By similarity HAMAP-Rule MF_03007.

Sequence similarities: Belongs to the eIF-3 subunit H family.Contains 1 MPN (JAB/Mov34) domain.

Similar Products

Product Notes

The LOC100190645 eif3h (Catalog #AAA6000066) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF3H (Eukaryotic Translation Initiation Factor 3 Subunit H, eIF3h, Eukaryotic Translation Initiation Factor 3 Subunit 3, eIF-3 gamma, eIF3 p40 Subunit, EIF3S3, MGC102958) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3H can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the LOC100190645 eif3h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YDPIKTAQGS LSLKAYRLTP KLMEVCKEKD FSPEALKKAN ITFEYMFEEV PIVIKNSHLI NVLMWELEKK SAVADKHELL SLASSNHLGK NLQLLMDRV*. It is sometimes possible for the material contained within the vial of "EIF3H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.