Mouse anti-Human EIF3H Monoclonal Antibody | anti-EIF3H antibody

EIF3H (Eukaryotic Translation Initiation Factor 3 Subunit H, eIF3h, Eukaryotic Translation Initiation Factor 3 Subunit 3, eIF-3 gamma, eIF3 p40 Subunit, EIF3S3, MGC102958) (Biotin)

Cat. Num. AAA6141693

• Gene Names: EIF3H; EIF3S3; eIF3-p40; eIF3-gamma
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF3H; Monoclonal Antibody; EIF3H (Eukaryotic Translation Initiation Factor 3 Subunit H; eIF3h; Eukaryotic Translation Initiation Factor 3 Subunit 3; eIF-3 gamma; eIF3 p40 Subunit; EIF3S3; MGC102958) (Biotin); anti-EIF3H antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B12
• Specificity: Recognizes human EIF3S3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-EIF3H antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa152-251 from EIF3S3 (NP_003747) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRV*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(EIF3S3 monoclonal antibody Western Blot analysis of EIF3S3 expression in Jurkat.)

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged EIF3S3 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-EIF3H antibody

Antibodies; Translation Initiation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4503515
• NCBI GeneID: 8667
• NCBI Accession #: NP_003747
• NCBI GenBank Nucleotide #: NM_003756
• UniProt Accession #: O15372
• Molecular Weight: 39,930 Da
• NCBI Official Full Name: eukaryotic translation initiation factor 3 subunit H
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 3, subunit H
• NCBI Official Symbol: EIF3H
• NCBI Official Synonym Symbols: EIF3S3; eIF3-p40; eIF3-gamma
• NCBI Protein Information: eukaryotic translation initiation factor 3 subunit H; EIF3H; eIF-3-gamma; eIF3 p40 subunit; eukaryotic translation initiation factor 3 subunit 3; eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD); eukaryotic translation initiation factor
• UniProt Protein Name: Eukaryotic translation initiation factor 3 subunit H
• UniProt Gene Name: EIF3H
• UniProt Entry Name: EIF3H_HUMAN

Uniprot Description

eIF3S3: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M. The eIF-3 complex appears to include 3 stable modules: module A is composed of EIF3A, EIF3B, EIF3G and EIF3I; module B is composed of EIF3F, EIF3H, and EIF3M; and module C is composed of EIF3C, EIF3D, EIF3E, EIF3K and EIF3L. EIF3C of module C binds EIF3B of module A and EIF3H of module B, thereby linking the three modules. EIF3J is a labile subunit that binds to the eIF-3 complex via EIF3B. The eIF-3 complex interacts with RPS6KB1 under conditions of nutrient depletion. Mitogenic stimulation leads to binding and activation of a complex composed of MTOR and RPTOR, leading to phosphorylation and release of RPS6KB1 and binding of EIF4B to eIF-3. Interacts with RNF139; the interaction leads to protein translation inhibitions in a ubiquitination- dependent manner. Belongs to the eIF-3 subunit H family.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 8q24.11

Cellular Component: eukaryotic translation initiation factor 3 complex; membrane; cytosol

Molecular Function: protein binding; translation initiation factor activity

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; formation of translation preinitiation complex; regulation of translational initiation