Mouse anti-Human CD19 Monoclonal Antibody | anti-CD19 antibody

CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (HRP)

Cat. Num. AAA6151643

• Gene Names: CD19; B4; CVID3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD19; Monoclonal Antibody; CD19 (B-lymphocyte Antigen CD19; B-lymphocyte Surface Antigen B4; Differentiation Antigen CD19; T-cell Surface Antigen Leu-12) (HRP); anti-CD19 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C9
• Specificity: Recognizes human CD19.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CD19 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa98-187 from human CD19 (NP_001761) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged CD19 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-CD19 antibody

CD19 is a member of the immunoglobulin superfamily with 556aa and two immunoglobulin-like C2-type domains. As a cell surface protein, CD19 is known to form a complex with CD21, CD81 and CD225 in the membrane of mature B cells. A major function of CD19 is to assemble with the antigen receptor of B lymphocytes so as to decrease the threshold for antigen receptor dependent stimulation thus enhancing the specificity and sensitivity of B cells towards antigens. CD19 is an important protein for B cell antigen receptor signaling and regulation and also acts as a specialized adaptor protein for the amplification of Src family needed for this purpose. Regulation of growth of B cells is a major function of CD19 and its expression is confined to only B lymphocytes and follicular dendritic cells of the hematopoietic system. Increased expression of CD19 induces the production of auto-antibody thus giving an insight to the regulatory role of CD19 in autoimmunity. Defects in CD19 are a cause of hypogammaglobulinemia.

Product Categories/Family for anti-CD19 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 91105174
• NCBI GeneID: 930
• NCBI Accession #: NP_001761
• NCBI GenBank Nucleotide #: NM_001770
• UniProt Accession #: P15391; Q96S68; Q9BRD6; A0N0P9; F5H635
• Molecular Weight: 61,200 Da
• NCBI Official Full Name: B-lymphocyte antigen CD19 isoform 2
• NCBI Official Synonym Full Names: CD19 molecule
• NCBI Official Symbol: CD19
• NCBI Official Synonym Symbols: B4; CVID3
• NCBI Protein Information: B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; T-cell surface antigen Leu-12; differentiation antigen CD19
• UniProt Protein Name: B-lymphocyte antigen CD19
• Protein Family: B-lymphocyte antigen
• UniProt Gene Name: CD19
• UniProt Entry Name: CD19_HUMAN

Uniprot Description

CD19: a cell surface molecule which assembles with the antigen receptor of B lymphocytes. A critical signal transduction molecule that regulates B lymphocyte development, activation, and differentiation. Ligation increases intracellular calcium levels and decreases the threshold for antigen receptor signaling. Germinal center formation is significantly reduced in CD19-deficient mice.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: protein complex; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: receptor signaling protein activity

Biological Process: epidermal growth factor receptor signaling pathway; B cell receptor signaling pathway; regulation of immune response; cell surface receptor linked signal transduction; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; cellular defense response; innate immune response; positive regulation of release of sequestered calcium ion into cytosol

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 3