Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human CD19 Monoclonal Antibody | anti-CD19 antibody

CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (PE)

Gene Names
CD19; B4; CVID3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD19; Monoclonal Antibody; CD19 (B-lymphocyte Antigen CD19; B-lymphocyte Surface Antigen B4; Differentiation Antigen CD19; T-cell Surface Antigen Leu-12) (PE); anti-CD19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C9
Specificity
Recognizes human CD19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CD19 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa98-187 from human CD19 (NP_001761) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Testing Data

(Detection limit for recombinant GST tagged CD19 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD19 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CD19 antibody
CD19 is a member of the immunoglobulin superfamily with 556aa and two immunoglobulin-like C2-type domains. As a cell surface protein, CD19 is known to form a complex with CD21, CD81 and CD225 in the membrane of mature B cells. A major function of CD19 is to assemble with the antigen receptor of B lymphocytes so as to decrease the threshold for antigen receptor dependent stimulation thus enhancing the specificity and sensitivity of B cells towards antigens. CD19 is an important protein for B cell antigen receptor signaling and regulation and also acts as a specialized adaptor protein for the amplification of Src family needed for this purpose. Regulation of growth of B cells is a major function of CD19 and its expression is confined to only B lymphocytes and follicular dendritic cells of the hematopoietic system. Increased expression of CD19 induces the production of auto-antibody thus giving an insight to the regulatory role of CD19 in autoimmunity. Defects in CD19 are a cause of hypogammaglobulinemia.
Product Categories/Family for anti-CD19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
930
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,200 Da
NCBI Official Full Name
B-lymphocyte antigen CD19 isoform 2
NCBI Official Synonym Full Names
CD19 molecule
NCBI Official Symbol
CD19
NCBI Official Synonym Symbols
B4; CVID3
NCBI Protein Information
B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; T-cell surface antigen Leu-12; differentiation antigen CD19
UniProt Protein Name
B-lymphocyte antigen CD19
Protein Family
UniProt Gene Name
CD19
UniProt Entry Name
CD19_HUMAN

Uniprot Description

CD19: a cell surface molecule which assembles with the antigen receptor of B lymphocytes. A critical signal transduction molecule that regulates B lymphocyte development, activation, and differentiation. Ligation increases intracellular calcium levels and decreases the threshold for antigen receptor signaling. Germinal center formation is significantly reduced in CD19-deficient mice.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: protein complex; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: receptor signaling protein activity

Biological Process: epidermal growth factor receptor signaling pathway; B cell receptor signaling pathway; regulation of immune response; cell surface receptor linked signal transduction; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; cellular defense response; innate immune response; positive regulation of release of sequestered calcium ion into cytosol

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 3

Similar Products

Product Notes

The CD19 cd19 (Catalog #AAA6156946) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD19 cd19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.