Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human TGOLN2 Monoclonal Antibody | anti-TGOLN2 antibody

TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, TGN38 Homolog, TGN46, TGN48, Trans-Golgi Network Protein TGN51, TGN51, TTGN2)

Gene Names
TGOLN2; TGN38; TGN46; TGN48; TGN51; TTGN2
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TGOLN2; Monoclonal Antibody; TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2; TGN38 Homolog; TGN46; TGN48; Trans-Golgi Network Protein TGN51; TGN51; TTGN2); Anti -TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2; anti-TGOLN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F11
Specificity
Recognizes human TGOLN2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
Applicable Applications for anti-TGOLN2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa229-327 from TGOLN2 (NP_006455) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TGOLN2 on HeLa cell . [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TGOLN2 on HeLa cell . [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TGOLN2 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TGOLN2 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TGOLN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,113 Da
NCBI Official Full Name
trans-Golgi network integral membrane protein 2 isoform 2
NCBI Official Synonym Full Names
trans-golgi network protein 2
NCBI Official Symbol
TGOLN2
NCBI Official Synonym Symbols
TGN38; TGN46; TGN48; TGN51; TTGN2
NCBI Protein Information
trans-Golgi network integral membrane protein 2; TGN38 homolog; trans-Golgi network protein TGN51; trans-Golgi network protein (46, 48, 51kD isoforms)
UniProt Protein Name
Trans-Golgi network integral membrane protein 2
UniProt Gene Name
TGOLN2
UniProt Synonym Gene Names
TGN46; TGN51
UniProt Entry Name
TGON2_HUMAN

NCBI Description

This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Function: May be involved in regulating membrane traffic to and from trans-Golgi network.

Subcellular location: Cell membrane; Single-pass type I membrane protein. Golgi apparatus › trans-Golgi network membrane; Single-pass type I membrane protein. Note: Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes.

Tissue specificity: Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.

Research Articles on TGOLN2

Similar Products

Product Notes

The TGOLN2 tgoln2 (Catalog #AAA648742) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, TGN38 Homolog, TGN46, TGN48, Trans-Golgi Network Protein TGN51, TGN51, TTGN2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGOLN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the TGOLN2 tgoln2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QGPIDGPSKS GAEEQTSKDS PNKVVPEQPS RKDHSKPISN PSDNKELPKA DTNQLADKGK LSPHAFKTES GEETDLISPP QEEVKSSEPT EDVEPKEAE. It is sometimes possible for the material contained within the vial of "TGOLN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.