Mouse anti-Human CASP14 Monoclonal Antibody | anti-CASP14 antibody

CASP14 (Caspase-14, CASP-14, Caspase-14 Subunit p19, Caspase-14 Subunit p10) (HRP)

Cat. Num. AAA6151581

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CASP14; Monoclonal Antibody; CASP14 (Caspase-14; CASP-14; Caspase-14 Subunit p19; Caspase-14 Subunit p10) (HRP); anti-CASP14 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C9
• Specificity: Recognizes human CASP14.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CASP14 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa133-243 from CASP14 (NP_036246) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(CASP14 monoclonal antibody. Western Blot analysis of CASP14 expression in MCF-7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CASP14 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-CASP14 antibody

CASP14 is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This caspase has been shown to be processed and activated by caspase 8 and caspase 10 in vitro, and by anti-Fas agonist antibody or TNF-related apoptosis inducing ligand in vivo.

Product Categories/Family for anti-CASP14 antibody

Antibodies; Apoptosis; Caspase

NCBI and Uniprot Product Information

• NCBI GI #: 6912286
• NCBI GeneID: 23581
• NCBI Accession #: NP_036246
• NCBI GenBank Nucleotide #: NM_012114
• UniProt Accession #: P31944; O95823; Q3SYC9
• Molecular Weight: 27,680 Da
• NCBI Official Full Name: caspase-14
• NCBI Official Synonym Full Names: caspase 14, apoptosis-related cysteine peptidase
• NCBI Official Symbol: CASP14
• NCBI Protein Information: caspase-14; CASP-14; apoptosis-related cysteine protease; caspase 14, apoptosis-related cysteine protease
• UniProt Protein Name: Caspase-14
• Protein Family: Caspase
• UniProt Gene Name: CASP14
• UniProt Synonym Gene Names: CASP-14
• UniProt Entry Name: CASPE_HUMAN

Uniprot Description

CASP14: Believed to be a non-apoptotic caspase which is involved in epidermal differentiation. Seems to play a role in keratinocyte differentiation and cornification. Probably regulates maturation of the epidermis by proteolytically processing filaggrin. Complex of unprocessed caspase-14 and processed 19 kDa (p19) and 10 kDa (p10) subunits. In undifferentiated keratinocytes under postconfluency growth conditions (in vitro). Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum). Expressed in keratinocytes of hair shaft and sebaceous glands. In psoriatic skin only expressed at very low levels. Belongs to the peptidase C14A family.

Protein type: Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: keratin filament; cytoplasm; nucleus

Molecular Function: cysteine-type endopeptidase activity

Biological Process: epidermis development; DNA damage response, signal transduction resulting in induction of apoptosis; keratinization; proteolysis