Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human CASP14 Monoclonal Antibody | anti-CASP14 antibody

CASP14 (Caspase-14, CASP-14, Caspase-14 Subunit p19, Caspase-14 Subunit p10) (PE)

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CASP14; Monoclonal Antibody; CASP14 (Caspase-14; CASP-14; Caspase-14 Subunit p19; Caspase-14 Subunit p10) (PE); anti-CASP14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C9
Specificity
Recognizes human CASP14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CASP14 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 15ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa133-243 from CASP14 (NP_036246) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(CASP14 monoclonal antibody. Western Blot analysis of CASP14 expression in MCF-7.)

Western Blot (WB) (CASP14 monoclonal antibody. Western Blot analysis of CASP14 expression in MCF-7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CASP14 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CASP14 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-CASP14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,680 Da
NCBI Official Full Name
caspase-14
NCBI Official Synonym Full Names
caspase 14, apoptosis-related cysteine peptidase
NCBI Official Symbol
CASP14
NCBI Protein Information
caspase-14; CASP-14; apoptosis-related cysteine protease; caspase 14, apoptosis-related cysteine protease
UniProt Protein Name
Caspase-14
Protein Family
UniProt Gene Name
CASP14
UniProt Synonym Gene Names
CASP-14
UniProt Entry Name
CASPE_HUMAN

Uniprot Description

CASP14: Believed to be a non-apoptotic caspase which is involved in epidermal differentiation. Seems to play a role in keratinocyte differentiation and cornification. Probably regulates maturation of the epidermis by proteolytically processing filaggrin. Complex of unprocessed caspase-14 and processed 19 kDa (p19) and 10 kDa (p10) subunits. In undifferentiated keratinocytes under postconfluency growth conditions (in vitro). Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum). Expressed in keratinocytes of hair shaft and sebaceous glands. In psoriatic skin only expressed at very low levels. Belongs to the peptidase C14A family.

Protein type: Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: keratin filament; cytoplasm; nucleus

Molecular Function: cysteine-type endopeptidase activity

Biological Process: epidermis development; DNA damage response, signal transduction resulting in induction of apoptosis; keratinization; proteolysis

Similar Products

Product Notes

The CASP14 casp14 (Catalog #AAA6156884) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CASP14 (Caspase-14, CASP-14, Caspase-14 Subunit p19, Caspase-14 Subunit p10) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASP14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 15ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CASP14 casp14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CASP14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.