Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CA10 is 1ng/ml using 124178 as a capture antibody.)

Mouse anti-Human CA10 Monoclonal Antibody | anti-CA10 antibody

CA10 (Carbonic Anhydrase-related Protein 10, Carbonic Anhydrase-related Protein X, CA-RP X, CARP X, Cerebral Protein 15, UNQ533/PRO1076, hucep-15) (MaxLight 650)

Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA10; Monoclonal Antibody; CA10 (Carbonic Anhydrase-related Protein 10; Carbonic Anhydrase-related Protein X; CA-RP X; CARP X; Cerebral Protein 15; UNQ533/PRO1076; hucep-15) (MaxLight 650); anti-CA10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A10
Specificity
Recognizes human CA10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
328
Applicable Applications for anti-CA10 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa229-328 from human CA10 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CA10 is 1ng/ml using 124178 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CA10 is 1ng/ml using 124178 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using 124178 (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen using 124178 (37.11kD).)
Related Product Information for anti-CA10 antibody
CA10 belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. This protein is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development.
Product Categories/Family for anti-CA10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
carbonic anhydrase-related protein 10
UniProt Protein Name
Carbonic anhydrase-related protein 10
UniProt Gene Name
CA10
UniProt Entry Name
CAH10_HUMAN

Similar Products

Product Notes

The CA10 ca10 (Catalog #AAA6221189) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CA10 (Carbonic Anhydrase-related Protein 10, Carbonic Anhydrase-related Protein X, CA-RP X, CARP X, Cerebral Protein 15, UNQ533/PRO1076, hucep-15) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CA10 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA10 ca10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.