Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 monoclonal antibody (M04), clone 3H1.Lane 1: BATF3 transfected lysate (Predicted MW: 14.5 KDa).Lane 2: Non-transfected lysate.)

Mouse BATF3 Monoclonal Antibody | anti-BATF3 antibody

BATF3 (Basic Leucine zipper Transcription Factor, ATF-like 3, JDP1, JUNDM1, SNFT) (PE)

Gene Names
BATF3; JDP1; SNFT; JUNDM1
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
BATF3; Monoclonal Antibody; BATF3 (Basic Leucine zipper Transcription Factor; ATF-like 3; JDP1; JUNDM1; SNFT) (PE); Basic Leucine zipper Transcription Factor; SNFT; anti-BATF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H1
Specificity
Recognizes BATF3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BATF3 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BATF3 (NP_061134.1, 1aa-127aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 monoclonal antibody (M04), clone 3H1.Lane 1: BATF3 transfected lysate (Predicted MW: 14.5 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 monoclonal antibody (M04), clone 3H1.Lane 1: BATF3 transfected lysate (Predicted MW: 14.5 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged BATF3 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BATF3 is 0.1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BATF3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BATF3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BATF3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BATF3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-BATF3 antibody
This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
Product Categories/Family for anti-BATF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,468 Da
NCBI Official Full Name
basic leucine zipper transcriptional factor ATF-like 3
NCBI Official Synonym Full Names
basic leucine zipper transcription factor, ATF-like 3
NCBI Official Symbol
BATF3
NCBI Official Synonym Symbols
JDP1; SNFT; JUNDM1
NCBI Protein Information
basic leucine zipper transcriptional factor ATF-like 3; 21 kDa small nuclear factor isolated from T-cells; 21-kD small nuclear factor isolated from T cells; B-ATF-3; Jun dimerization protein 1; Jun dimerization protein p21SNFT

NCBI Description

This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009]

Research Articles on BATF3

Similar Products

Product Notes

The BATF3 (Catalog #AAA6187503) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BATF3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BATF3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BATF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.