Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Rat BATF3 Polyclonal Antibody | anti-BATF3 antibody

BATF3 Polyclonal Antibody

Gene Names
BATF3; JDP1; SNFT; JUNDM1
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
BATF3; Polyclonal Antibody; BATF3 Polyclonal Antibody; JDP1; JUNDM1; SNFT; anti-BATF3 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Sequence Length
127
Applicable Applications for anti-BATF3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human BATF3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of rat spleen, using BATF3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

Related Product Information for anti-BATF3 antibody
This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
Product Categories/Family for anti-BATF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 14kDa
Observed: 14kDa
NCBI Official Full Name
basic leucine zipper transcriptional factor ATF-like 3
NCBI Official Synonym Full Names
basic leucine zipper ATF-like transcription factor 3
NCBI Official Symbol
BATF3
NCBI Official Synonym Symbols
JDP1; SNFT; JUNDM1
NCBI Protein Information
basic leucine zipper transcriptional factor ATF-like 3
UniProt Protein Name
Basic leucine zipper transcriptional factor ATF-like 3
UniProt Gene Name
BATF3
UniProt Synonym Gene Names
SNFT; B-ATF-3

NCBI Description

This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009]

Uniprot Description

AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (). Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes.

Research Articles on BATF3

Similar Products

Product Notes

The BATF3 batf3 (Catalog #AAA9134898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BATF3 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BATF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the BATF3 batf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQGLPAAGS VLQRSVAAPG NQPQPQPQQQ SPEDDDRKVR RREKNRVAAQ RSRKKQTQKA DKLHEEYESL EQENTMLRRE IGKLTEELKH LTEALKEHEK MCPLLLCPMN FVPVPPRPDP VAGCLPR. It is sometimes possible for the material contained within the vial of "BATF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual