Rabbit anti-Rat BATF3 Polyclonal Antibody | anti-BATF3 antibody

BATF3 Polyclonal Antibody

Cat. Num. AAA9134898

• Gene Names: BATF3; JDP1; SNFT; JUNDM1
• Reactivity: Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: BATF3; Polyclonal Antibody; BATF3 Polyclonal Antibody; JDP1; JUNDM1; SNFT; anti-BATF3 antibody

• Host: Rabbit
• Reactivity: Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
• Sequence Length: 127

• Applicable Applications for anti-BATF3 antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human BATF3
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Nucleus
• Positive Samples: Rat spleen
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of rat spleen, using BATF3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

Related Product Information for anti-BATF3 antibody

This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.

Product Categories/Family for anti-BATF3 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 8924246
• NCBI GeneID: 55509
• NCBI Accession #: NP_061134.1
• NCBI GenBank Nucleotide #: NM_018664.2
• UniProt Accession #: Q9NR55
• Molecular Weight: Calculated: 14kDa; Observed: 14kDa
• NCBI Official Full Name: basic leucine zipper transcriptional factor ATF-like 3
• NCBI Official Synonym Full Names: basic leucine zipper ATF-like transcription factor 3
• NCBI Official Symbol: BATF3
• NCBI Official Synonym Symbols: JDP1; SNFT; JUNDM1
• NCBI Protein Information: basic leucine zipper transcriptional factor ATF-like 3
• UniProt Protein Name: Basic leucine zipper transcriptional factor ATF-like 3
• Protein Family: Basic leucine zipper transcriptional factor
• UniProt Gene Name: BATF3
• UniProt Synonym Gene Names: SNFT; B-ATF-3

NCBI Description

This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009]

Uniprot Description

AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (). Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes.