Mouse anti-Human b2-Microglobulin Monoclonal Antibody | anti-HLA-G antibody

b2-Microglobulin (B2M, Beta-2-microglobulin, CDABP0092, HDCMA22P)

Cat. Num. AAA646087

• Gene Names: HLA-G; MHC-G
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: b2-Microglobulin; Monoclonal Antibody; b2-Microglobulin (B2M; Beta-2-microglobulin; CDABP0092; HDCMA22P); Anti -b2-Microglobulin (B2M; anti-HLA-G antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F9-2C2
• Specificity: Recognizes human B2M.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

• Applicable Applications for anti-HLA-G antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length recombinant corresponding to aa1-119 from human B2M (AAH32589) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged B2M is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CALR and B2M. HeLa cells were stained with CALR rabbit purified polyclonal 1:1200 and B2M mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(B2M monoclonal antibody, Western Blot analysis of B2M expression in U-2 OS.)

Western Blot (WB)

(Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody.|Lane 1: B2M transfected lysate (13.7kD).|Lane 2: Non-transfected lysate.)

Related Product Information for anti-HLA-G antibody

Beta-2-microglobulin is a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells.

Product Categories/Family for anti-HLA-G antibody

Antibodies; Abs to Serum Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 188468
• NCBI GeneID: 3135
• UniProt Accession #: P17693
• Molecular Weight: 38,224 Da
• NCBI Official Full Name: b2 microglobulin
• NCBI Official Synonym Full Names: major histocompatibility complex, class I, G
• NCBI Official Symbol: HLA-G
• NCBI Official Synonym Symbols: MHC-G
• NCBI Protein Information: HLA class I histocompatibility antigen, alpha chain G; HLA G antigen; b2 microglobulin; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G
• UniProt Protein Name: HLA class I histocompatibility antigen, alpha chain G
• Protein Family: HLA class I histocompatibility antigen
• UniProt Gene Name: HLA-G
• UniProt Synonym Gene Names: HLA-6.0; HLAG
• UniProt Entry Name: HLAG_HUMAN

NCBI Description

HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Subunit structure: Heterodimer of an alpha chain and a beta chain (beta-2-microglobulin). Homodimer; disulfide-linked. Binds to LILRB1 and LILRB2. Ref.6 Ref.8

Subcellular location: Membrane; Single-pass type I membrane protein.

Tissue specificity: Expressed in trophoblasts.

Sequence similarities: Belongs to the MHC class I family.Contains 1 Ig-like C1-type (immunoglobulin-like) domain.