Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (B2M rabbit polyclonal antibody. Western Blot analysis of B2M expression in human placenta.)

Rabbit anti-Human b2-Microglobulin Polyclonal Antibody | anti-B2M antibody

b2-Microglobulin (B2M, Beta-2-microglobulin) (AP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
b2-Microglobulin; Polyclonal Antibody; b2-Microglobulin (B2M; Beta-2-microglobulin) (AP); anti-B2M antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human B2M.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-B2M antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human B2M, aa1-119 (NP_004039.1).
Immunogen Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(B2M rabbit polyclonal antibody. Western Blot analysis of B2M expression in human placenta.)

Western Blot (WB) (B2M rabbit polyclonal antibody. Western Blot analysis of B2M expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of B2M expression in transfected 293T cell line by B2M polyclonal antibody. Lane 1: B2M transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of B2M expression in transfected 293T cell line by B2M polyclonal antibody. Lane 1: B2M transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-B2M antibody
Beta-2-microglobulin is a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells.
Product Categories/Family for anti-B2M antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
567
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
beta-2-microglobulin
NCBI Official Synonym Full Names
beta-2-microglobulin
NCBI Official Symbol
B2M
NCBI Protein Information
beta-2-microglobulin; beta chain of MHC class I molecules; beta-2-microglobin
UniProt Protein Name
Beta-2-microglobulin
Protein Family
UniProt Gene Name
B2M
UniProt Entry Name
B2MG_HUMAN

NCBI Description

This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014]

Uniprot Description

B2M: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Heterodimer of an alpha chain and a beta chain. Beta-2- microglobulin is the beta-chain of major histocompatibility complex class I molecules. Polymers of beta 2-microglobulin can be found in tissues from patients on long-term hemodialysis. Belongs to the beta-2-microglobulin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: Golgi membrane; Golgi apparatus; extracellular space; phagocytic vesicle membrane; focal adhesion; membrane; early endosome membrane; endoplasmic reticulum lumen; cytoplasm; plasma membrane; extracellular region; MHC class I protein complex; external side of plasma membrane

Molecular Function: identical protein binding; protein binding

Biological Process: response to drug; regulation of immune response; viral reproduction; positive regulation of T cell mediated cytotoxicity; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; cytokine and chemokine mediated signaling pathway; T cell differentiation in the thymus; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; regulation of defense response to virus by virus; retinal homeostasis; iron ion homeostasis; antigen processing and presentation of peptide antigen via MHC class I; response to cadmium ion; response to molecule of bacterial origin; antigen processing and presentation of exogenous peptide antigen via MHC class I; innate immune response; protein refolding; antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent

Disease: Hypoproteinemia, Hypercatabolic

Research Articles on B2M

Similar Products

Product Notes

The B2M b2m (Catalog #AAA6385445) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The b2-Microglobulin (B2M, Beta-2-microglobulin) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's b2-Microglobulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the B2M b2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "b2-Microglobulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.